Fungal Genomics

at Utrecht University

General Properties

Protein IDOphcf2|00828
Gene name
Locationscaffold_01:3212375..3217537
Strand-
Gene length (bp)5162
Transcript length (bp)5031
Coding sequence length (bp)5031
Protein length (aa) 1677

Overview

Your browser does not support drawing a protein figure.

PFAM Domains

PFAM Domain ID Short name Long name E-value Start End
PF00780 CNH CNH domain 5.7E-58 1337 1621
PF00621 RhoGEF RhoGEF domain 1.3E-37 868 1052
PF15405 PH_5 Pleckstrin homology domain 1.2E-08 1091 1249

GO

GO Term Description Terminal node
GO:0005085 guanyl-nucleotide exchange factor activity Yes
GO:0060589 nucleoside-triphosphatase regulator activity No
GO:0030695 GTPase regulator activity No
GO:0098772 molecular function regulator activity No
GO:0003674 molecular_function No
GO:0030234 enzyme regulator activity No

Deeploc

[Help with interpreting the results of Deeploc 2.0]
Localizations Signals Cytoplasm Nucleus Extracellular Cell membrane Mitochondrion Plastid Endoplasmic reticulum Lysosome vacuole Golgi apparatus Peroxisome
Cytoplasm 0.5994 0.3887 0.0366 0.131 0.1103 0.0061 0.092 0.4577 0.1336 0.0073

SignalP

(None)

Transmembrane Domains

(None)

Transcription Factor Class

(None)

CAZymes

(None)

Secondary Metabolism

(None)

Expression data

Analysis 1: Expression analysis during behavioral modification. Published in: Will et al., G3, 2020

Expression values

Label Description Expression (RPKM) Confidence interval (low) Confidence interval (high)
Fungus Fungus in pure culture 21.71 12.46 30.95
Alive In ants, during behavior modification 25.63 14.52 36.73
Dead In ants, recently dead 21.60 12.24 30.95

Differential expression

Label1 Label2 Q-value Significant difference
Alive Fungus 0.407842 no
Alive Dead 0.324674 no
Dead Fungus 0.984770 no

Orthologs

Orthofinder run ID4
Orthogroup4180
Change Orthofinder run
Species Protein ID
Ophiocordyceps australis 1348a (Ghana) OphauG2|3570
Ophiocordyceps australis map64 (Brazil) OphauB2|3105
Ophiocordyceps camponoti-floridani Ophcf2|00828 (this protein)
Ophiocordyceps camponoti-rufipedis Ophun1|5526
Ophiocordyceps kimflemingae Ophio5|4728
Ophiocordyceps subramaniannii Hirsu2|8490

Sequences

Type of sequenceSequence
Locus Download genbank file of locus Download genbank file of locus (reverse complement)
The gene with 5 kb flanks (if sufficient flanking sequence is available). For use in cloning design programs. NOTE: features (genes or exons) that are only partially contained within the sequence are completely excluded.
Protein >Ophcf2|00828
MSFRADDQRRYGHVPPVQYPVPGHHPDRQAAGRRLSFNSGDDAAYYGPQSPAAPPHHPPAEDELFFNPSSTSPSA
YGSSNSAYQRQYQSTTPRTPPTHSTYNPQAFSTPSASAALRNSPSAALPHQPHSSPRYSGSSYGTSPPAGYAPQV
YNPAAYADTNGHQRQPVHAGYPQDQVYAAVRGQSPASAYTAAFPHQLPSTGQSAGQALTYDPSQYASYGDAQPSA
SHASVSHLPYPTTSQIPVGPNYQDQLSYFSRPVRSDSQQSSRASPYMHPHSPSGLQRHPTNAPLPSRPMNEPMDE
LYWDVNGRLSGRDRNLELVTPESIMEEIEAELGETSHRSRRRPSPMNGQPSHEQVQRAPPHVPPHSPSASPGRAP
VHYDDDDDDDDDDDPEGTAGVLAMRQAELDEERFSGNAFMYSDFPAPLPVPPKNPLPPPPELQDASSDSDFGSNV
DLGIMSGGHAGDLTYGEHVGSFSGALSLPAVTRPLPMPTYGAESYDETPPFNAEMDYVGTGGLRAPRASRLSFDE
GRDERVSIHSGDSRRSGSGSPVKDDYQDLFYHPGLSSRPLPALPPGPGSDSSSMLSARNSLHSQNQNQHQHSLSA
DARYYQADAPEAFYQSTSQQMLQPERSISLSGHSHTPQVQAPTRSRTDATEERKKISRQQQLALQQGPVLSEHNE
SGPGFPPGAFDSITLPSGRKKKFVPSKLLASDFRKCSEAWALSAVEAWVRLMGEGEIDLKEKTVEEAVTNLFAFK
VPTMNVADAETLSSHVVRLMLDSGLLLPDEEWVKFGDGHISGILWQLTGSGCYAPKLHAFEASGHCYSHLCTRTV
RKFELDDLESDDAEKKEWHVYHNLRPEEISAKGGKEVARQNNLHEIVTGEHHYVKQLDIFRNIYRESLRRRQPPI
IHPEKQAKFFNAVFGNMDAVSAVHKQHLLSRLRHRRDAQGPWIVGFSDIFREWIRKAKSDYIEYAACYPRAKYLL
QKESERNVLFQKFNEEMRKDKASSKQDWTHFLLAPIQRLPRYILLLETVEKNTVDESEEKTNLQRAIQEIRTVTI
ECDAKVAETEARVHMMALDQMLVLRPGFQSVLNLHHLGRALIKQGELQRMGSKGMRWVDTHALLFDHYLILSKVV
FTKDGRAEKKFDVSREPIPMPLLLLESMNDEPVTKQKVITAPLSRTTAASASGTQLNKAASNGGGRQALEHAATG
SSMSSLTTVTTFDSESKVIYPFRVKHLGHEVYTLHAPSARDRRDWCVSIIDAKTRHAESLFSQNAEPFRLRVLAD
ASFHYDANSIYMRASGVHVKGTPLDRAIQELESVMGSSQGIAPVCRAQVNCAAGFSAFGRPLLAIGTDYGIFVTD
PAEPRGWRRTVQTARVTQMAVLEEFSVCLAIADKSLVSYPLDVVAPNSDLAPPMSDSPRRAPQRLAKDVTYFATA
RMKDRTLVFYKRKEGLHTSFKVLEPILHKATEKRSRFGRRAIARSTDTFRDFDEFYLPTECYSLSLFQTYIAVAT
AKGVEMLTLDKKQPMSIPDLKAPAIANIAGRVRDQRPLGMFRLNDSEFILTYEDCAVYVDKHGDVSRTLIMEYTG
KQKKARSATMYGQYLLLFNDDYVEVRNADNGRLRQIIAGRDVRVIDYGVRGPTGGNASATQVNGHAPGDVSKGTV
KISMCHPEQAGKQIVLEMLLNDGHVD*
Coding >Ophcf2|00828
ATGTCGTTCCGCGCCGATGATCAGCGTCGCTACGGCCACGTTCCGCCCGTCCAGTATCCTGTTCCCGGACATCAC
CCCGATCGTCAGGCGGCAGGTCGACGTCTGAGCTTCAACAGCGGTGACGACGCTGCCTACTACGGCCCTCAGTCG
CCCGCTGCACCTCCTCACCATCCCCCCGCCGAGGACGAACTCTTCTTCAACCCGAGCTCCACCAGCCCTTCGGCT
TATGGCTCATCCAACAGCGCCTACCAACGCCAGTATCAGAGCACCACGCCCCGTACGCCCCCGACTCATTCCACC
TACAACCCCCAGGCCTTTTCCACTCCATCCGCCTCGGCCGCTCTGCGAAACTCCCCGTCGGCTGCTCTCCCTCAC
CAGCCGCACTCGTCGCCGCGATACTCAGGCAGCTCCTACGGCACATCTCCTCCGGCTGGTTACGCCCCGCAGGTC
TATAATCCAGCCGCCTACGCCGATACAAATGGCCATCAGCGTCAGCCTGTCCATGCCGGCTATCCTCAAGACCAA
GTCTACGCCGCCGTCCGCGGCCAATCGCCGGCCTCGGCCTATACAGCTGCCTTTCCTCATCAGCTGCCCTCTACC
GGTCAGTCTGCCGGTCAAGCCTTGACCTATGATCCTTCTCAGTATGCCTCGTACGGTGACGCCCAGCCGTCGGCC
TCGCACGCGTCTGTCTCCCACCTCCCGTATCCAACCACGTCGCAAATACCCGTCGGCCCCAACTACCAGGATCAG
CTTTCGTACTTTAGCCGTCCCGTTCGGTCGGACTCGCAGCAGTCATCGCGAGCTTCTCCCTACATGCATCCGCAC
TCGCCTTCTGGTCTCCAGCGGCATCCGACCAATGCCCCCCTTCCCAGCCGGCCGATGAACGAGCCGATGGACGAG
CTTTATTGGGACGTCAATGGTCGGCTCTCGGGCAGGGACCGCAACCTGGAGCTGGTGACGCCCGAGAGCATCATG
GAAGAAATCGAGGCCGAGCTGGGCGAGACCAGTCACAGATCCCGACGGCGTCCATCCCCGATGAACGGCCAGCCG
TCTCATGAGCAGGTCCAGCGGGCGCCGCCTCATGTCCCACCGCACTCTCCCTCGGCGTCTCCGGGCAGAGCTCCG
GTCCACTACGATGACGATGACGACGATGACGACGATGACGACCCTGAAGGGACTGCTGGCGTGCTGGCCATGCGA
CAGGCTGAACTTGACGAGGAGCGGTTCAGCGGCAACGCCTTCATGTACAGCGACTTCCCTGCGCCCTTGCCGGTC
CCCCCCAAAAACCCGTTGCCTCCGCCGCCCGAGCTGCAGGATGCCAGCAGCGACAGCGATTTCGGGAGCAACGTC
GACTTGGGTATCATGAGTGGTGGCCACGCAGGCGACTTGACATATGGCGAGCATGTCGGATCCTTCTCCGGCGCC
CTTTCTTTGCCAGCAGTCACACGGCCGTTGCCGATGCCAACTTACGGGGCCGAGAGCTATGACGAAACGCCTCCC
TTCAACGCTGAGATGGACTATGTCGGTACCGGCGGGTTGCGCGCCCCGAGGGCATCGCGACTGAGTTTCGACGAA
GGCCGGGATGAGAGGGTTTCTATTCACTCGGGAGACTCACGACGGAGCGGTTCTGGGTCGCCCGTCAAGGACGAT
TATCAGGACCTCTTTTACCATCCCGGCCTCTCCAGCAGGCCGTTGCCGGCTCTGCCTCCGGGCCCTGGGTCTGAT
AGCAGCTCGATGCTGTCGGCTCGCAACAGCCTCCATTCGCAGAACCAAAATCAGCACCAGCACTCGCTGAGCGCC
GACGCCCGCTACTACCAGGCCGACGCTCCCGAGGCCTTTTATCAGTCAACATCGCAGCAGATGCTGCAGCCGGAG
AGGTCCATCTCGCTCTCCGGCCACAGTCACACGCCGCAGGTTCAGGCCCCTACTAGATCACGGACGGATGCGACC
GAGGAGCGCAAAAAGATCAGCCGGCAGCAGCAGTTGGCCCTGCAGCAGGGACCGGTACTCTCCGAGCACAACGAG
TCGGGACCCGGCTTCCCTCCCGGTGCCTTTGACAGCATCACGTTGCCGAGCGGGCGCAAGAAGAAGTTTGTGCCG
TCGAAACTGTTGGCATCGGACTTTCGCAAGTGCTCGGAAGCATGGGCACTCAGCGCCGTCGAGGCTTGGGTGCGG
CTGATGGGAGAAGGCGAGATTGATCTCAAAGAGAAGACGGTGGAAGAGGCAGTGACGAACCTGTTTGCCTTTAAG
GTGCCGACGATGAACGTTGCGGATGCCGAGACGCTCAGCAGCCACGTGGTTCGGCTCATGCTCGACTCTGGCCTC
TTGTTACCGGACGAGGAATGGGTCAAGTTTGGCGACGGGCATATATCCGGCATTCTCTGGCAGCTGACCGGTTCG
GGCTGCTACGCCCCCAAGCTTCACGCATTCGAGGCGAGCGGCCACTGCTACTCGCATCTGTGCACGCGTACCGTC
CGCAAGTTTGAGCTGGACGATCTGGAATCGGACGACGCAGAGAAGAAGGAATGGCACGTCTACCACAACCTGAGG
CCGGAGGAGATCAGCGCCAAAGGCGGCAAGGAGGTGGCGCGGCAGAACAACCTGCACGAGATTGTCACGGGCGAA
CATCACTACGTTAAGCAGCTGGATATCTTCCGCAACATCTACCGCGAGAGCCTGCGGAGGCGGCAGCCGCCCATC
ATCCACCCCGAGAAGCAGGCAAAGTTCTTCAACGCCGTCTTTGGCAACATGGACGCCGTATCGGCCGTTCACAAG
CAGCACCTCCTGTCAAGGCTCAGGCACCGTCGGGACGCTCAGGGCCCGTGGATCGTCGGCTTCAGCGACATCTTT
CGCGAGTGGATTCGCAAAGCCAAGTCGGACTACATTGAGTACGCGGCCTGCTATCCGCGGGCCAAGTATCTGCTG
CAGAAGGAGTCGGAGCGCAACGTCTTGTTTCAGAAGTTTAACGAGGAGATGCGCAAGGACAAGGCGTCTTCGAAG
CAGGACTGGACGCATTTCCTGCTCGCCCCCATCCAGCGGCTGCCGCGATACATTCTCCTGCTGGAGACGGTGGAG
AAGAACACGGTGGACGAGAGCGAGGAAAAGACGAACCTGCAGAGGGCCATCCAGGAGATCCGGACGGTGACGATT
GAGTGCGACGCCAAGGTGGCCGAGACGGAGGCGCGGGTGCACATGATGGCGCTGGACCAGATGCTCGTGCTGCGG
CCAGGCTTCCAGTCGGTGCTGAACCTGCACCACCTCGGCAGGGCCCTCATCAAGCAGGGCGAGCTGCAGAGGATG
GGGTCCAAGGGGATGCGTTGGGTCGACACGCACGCCCTGCTGTTCGATCACTACCTGATTCTGTCCAAGGTAGTC
TTCACCAAAGACGGCAGGGCGGAGAAGAAGTTTGACGTTTCGCGCGAGCCCATCCCGATGCCGCTGCTGCTCCTG
GAGAGCATGAATGACGAGCCGGTGACGAAGCAAAAGGTCATTACGGCGCCTCTGAGCCGGACAACGGCCGCCTCT
GCCTCGGGCACGCAACTTAACAAGGCGGCCAGCAACGGCGGAGGCCGGCAAGCGCTCGAGCACGCGGCAACGGGT
TCGTCGATGAGTAGCCTGACGACGGTCACTACGTTTGACTCGGAGAGCAAAGTCATCTATCCATTCCGGGTGAAG
CATCTGGGCCACGAGGTGTACACTCTGCACGCCCCGTCGGCGCGGGACCGGCGAGACTGGTGCGTGAGCATCATC
GACGCCAAGACGAGGCACGCCGAGTCTTTGTTCTCGCAGAACGCTGAGCCGTTTCGGCTACGGGTCTTGGCCGAC
GCCTCCTTTCACTACGACGCCAACTCGATATATATGCGCGCCTCGGGCGTGCACGTCAAGGGGACGCCGCTGGAC
AGGGCCATTCAGGAGCTGGAGAGCGTCATGGGCTCGTCCCAGGGCATCGCGCCCGTGTGCCGAGCGCAGGTCAAC
TGTGCGGCGGGCTTCTCGGCGTTTGGGAGGCCGCTGCTGGCCATCGGGACCGACTACGGCATCTTTGTGACCGAC
CCGGCCGAGCCCCGGGGATGGCGTCGGACTGTACAGACAGCGCGGGTGACGCAGATGGCGGTGCTGGAAGAGTTT
TCCGTATGCCTGGCCATCGCGGACAAGTCGCTCGTGTCGTATCCGCTCGACGTCGTGGCGCCCAACTCGGATCTG
GCACCGCCCATGAGCGACAGTCCTCGACGGGCACCGCAGCGGCTGGCCAAGGACGTTACGTACTTTGCCACGGCG
CGGATGAAGGATCGGACGCTCGTCTTTTACAAGCGAAAGGAGGGCCTCCATACGTCGTTCAAGGTGTTGGAGCCC
ATCCTCCACAAGGCTACGGAGAAGCGTTCACGCTTCGGACGGCGGGCGATTGCCCGGAGCACGGACACGTTCCGC
GACTTTGACGAGTTTTACCTGCCAACAGAGTGCTATTCACTCAGCCTGTTTCAGACATACATCGCCGTGGCCACG
GCCAAGGGCGTCGAGATGCTCACGCTGGACAAGAAGCAGCCCATGTCGATCCCGGACCTCAAGGCGCCGGCCATT
GCCAACATTGCCGGGCGTGTCCGTGACCAGCGGCCGCTCGGCATGTTTCGACTCAACGACAGCGAGTTCATCCTA
ACGTACGAGGACTGCGCCGTCTACGTCGACAAGCACGGCGACGTCAGCCGCACCCTCATCATGGAGTACACGGGC
AAGCAGAAAAAGGCCCGGAGCGCGACCATGTACGGCCAGTACCTGCTGCTCTTCAACGACGACTACGTCGAGGTG
CGCAACGCCGACAACGGCCGACTGCGGCAGATTATCGCCGGTCGTGACGTCCGTGTCATCGACTACGGCGTCCGG
GGCCCGACGGGGGGCAACGCCTCGGCGACGCAGGTAAACGGACACGCGCCGGGAGACGTCAGCAAGGGCACCGTC
AAGATCTCCATGTGCCATCCCGAACAGGCGGGGAAGCAGATCGTGCTCGAGATGCTGCTCAACGACGGACACGTG
GATTGA
Transcript >Ophcf2|00828
ATGTCGTTCCGCGCCGATGATCAGCGTCGCTACGGCCACGTTCCGCCCGTCCAGTATCCTGTTCCCGGACATCAC
CCCGATCGTCAGGCGGCAGGTCGACGTCTGAGCTTCAACAGCGGTGACGACGCTGCCTACTACGGCCCTCAGTCG
CCCGCTGCACCTCCTCACCATCCCCCCGCCGAGGACGAACTCTTCTTCAACCCGAGCTCCACCAGCCCTTCGGCT
TATGGCTCATCCAACAGCGCCTACCAACGCCAGTATCAGAGCACCACGCCCCGTACGCCCCCGACTCATTCCACC
TACAACCCCCAGGCCTTTTCCACTCCATCCGCCTCGGCCGCTCTGCGAAACTCCCCGTCGGCTGCTCTCCCTCAC
CAGCCGCACTCGTCGCCGCGATACTCAGGCAGCTCCTACGGCACATCTCCTCCGGCTGGTTACGCCCCGCAGGTC
TATAATCCAGCCGCCTACGCCGATACAAATGGCCATCAGCGTCAGCCTGTCCATGCCGGCTATCCTCAAGACCAA
GTCTACGCCGCCGTCCGCGGCCAATCGCCGGCCTCGGCCTATACAGCTGCCTTTCCTCATCAGCTGCCCTCTACC
GGTCAGTCTGCCGGTCAAGCCTTGACCTATGATCCTTCTCAGTATGCCTCGTACGGTGACGCCCAGCCGTCGGCC
TCGCACGCGTCTGTCTCCCACCTCCCGTATCCAACCACGTCGCAAATACCCGTCGGCCCCAACTACCAGGATCAG
CTTTCGTACTTTAGCCGTCCCGTTCGGTCGGACTCGCAGCAGTCATCGCGAGCTTCTCCCTACATGCATCCGCAC
TCGCCTTCTGGTCTCCAGCGGCATCCGACCAATGCCCCCCTTCCCAGCCGGCCGATGAACGAGCCGATGGACGAG
CTTTATTGGGACGTCAATGGTCGGCTCTCGGGCAGGGACCGCAACCTGGAGCTGGTGACGCCCGAGAGCATCATG
GAAGAAATCGAGGCCGAGCTGGGCGAGACCAGTCACAGATCCCGACGGCGTCCATCCCCGATGAACGGCCAGCCG
TCTCATGAGCAGGTCCAGCGGGCGCCGCCTCATGTCCCACCGCACTCTCCCTCGGCGTCTCCGGGCAGAGCTCCG
GTCCACTACGATGACGATGACGACGATGACGACGATGACGACCCTGAAGGGACTGCTGGCGTGCTGGCCATGCGA
CAGGCTGAACTTGACGAGGAGCGGTTCAGCGGCAACGCCTTCATGTACAGCGACTTCCCTGCGCCCTTGCCGGTC
CCCCCCAAAAACCCGTTGCCTCCGCCGCCCGAGCTGCAGGATGCCAGCAGCGACAGCGATTTCGGGAGCAACGTC
GACTTGGGTATCATGAGTGGTGGCCACGCAGGCGACTTGACATATGGCGAGCATGTCGGATCCTTCTCCGGCGCC
CTTTCTTTGCCAGCAGTCACACGGCCGTTGCCGATGCCAACTTACGGGGCCGAGAGCTATGACGAAACGCCTCCC
TTCAACGCTGAGATGGACTATGTCGGTACCGGCGGGTTGCGCGCCCCGAGGGCATCGCGACTGAGTTTCGACGAA
GGCCGGGATGAGAGGGTTTCTATTCACTCGGGAGACTCACGACGGAGCGGTTCTGGGTCGCCCGTCAAGGACGAT
TATCAGGACCTCTTTTACCATCCCGGCCTCTCCAGCAGGCCGTTGCCGGCTCTGCCTCCGGGCCCTGGGTCTGAT
AGCAGCTCGATGCTGTCGGCTCGCAACAGCCTCCATTCGCAGAACCAAAATCAGCACCAGCACTCGCTGAGCGCC
GACGCCCGCTACTACCAGGCCGACGCTCCCGAGGCCTTTTATCAGTCAACATCGCAGCAGATGCTGCAGCCGGAG
AGGTCCATCTCGCTCTCCGGCCACAGTCACACGCCGCAGGTTCAGGCCCCTACTAGATCACGGACGGATGCGACC
GAGGAGCGCAAAAAGATCAGCCGGCAGCAGCAGTTGGCCCTGCAGCAGGGACCGGTACTCTCCGAGCACAACGAG
TCGGGACCCGGCTTCCCTCCCGGTGCCTTTGACAGCATCACGTTGCCGAGCGGGCGCAAGAAGAAGTTTGTGCCG
TCGAAACTGTTGGCATCGGACTTTCGCAAGTGCTCGGAAGCATGGGCACTCAGCGCCGTCGAGGCTTGGGTGCGG
CTGATGGGAGAAGGCGAGATTGATCTCAAAGAGAAGACGGTGGAAGAGGCAGTGACGAACCTGTTTGCCTTTAAG
GTGCCGACGATGAACGTTGCGGATGCCGAGACGCTCAGCAGCCACGTGGTTCGGCTCATGCTCGACTCTGGCCTC
TTGTTACCGGACGAGGAATGGGTCAAGTTTGGCGACGGGCATATATCCGGCATTCTCTGGCAGCTGACCGGTTCG
GGCTGCTACGCCCCCAAGCTTCACGCATTCGAGGCGAGCGGCCACTGCTACTCGCATCTGTGCACGCGTACCGTC
CGCAAGTTTGAGCTGGACGATCTGGAATCGGACGACGCAGAGAAGAAGGAATGGCACGTCTACCACAACCTGAGG
CCGGAGGAGATCAGCGCCAAAGGCGGCAAGGAGGTGGCGCGGCAGAACAACCTGCACGAGATTGTCACGGGCGAA
CATCACTACGTTAAGCAGCTGGATATCTTCCGCAACATCTACCGCGAGAGCCTGCGGAGGCGGCAGCCGCCCATC
ATCCACCCCGAGAAGCAGGCAAAGTTCTTCAACGCCGTCTTTGGCAACATGGACGCCGTATCGGCCGTTCACAAG
CAGCACCTCCTGTCAAGGCTCAGGCACCGTCGGGACGCTCAGGGCCCGTGGATCGTCGGCTTCAGCGACATCTTT
CGCGAGTGGATTCGCAAAGCCAAGTCGGACTACATTGAGTACGCGGCCTGCTATCCGCGGGCCAAGTATCTGCTG
CAGAAGGAGTCGGAGCGCAACGTCTTGTTTCAGAAGTTTAACGAGGAGATGCGCAAGGACAAGGCGTCTTCGAAG
CAGGACTGGACGCATTTCCTGCTCGCCCCCATCCAGCGGCTGCCGCGATACATTCTCCTGCTGGAGACGGTGGAG
AAGAACACGGTGGACGAGAGCGAGGAAAAGACGAACCTGCAGAGGGCCATCCAGGAGATCCGGACGGTGACGATT
GAGTGCGACGCCAAGGTGGCCGAGACGGAGGCGCGGGTGCACATGATGGCGCTGGACCAGATGCTCGTGCTGCGG
CCAGGCTTCCAGTCGGTGCTGAACCTGCACCACCTCGGCAGGGCCCTCATCAAGCAGGGCGAGCTGCAGAGGATG
GGGTCCAAGGGGATGCGTTGGGTCGACACGCACGCCCTGCTGTTCGATCACTACCTGATTCTGTCCAAGGTAGTC
TTCACCAAAGACGGCAGGGCGGAGAAGAAGTTTGACGTTTCGCGCGAGCCCATCCCGATGCCGCTGCTGCTCCTG
GAGAGCATGAATGACGAGCCGGTGACGAAGCAAAAGGTCATTACGGCGCCTCTGAGCCGGACAACGGCCGCCTCT
GCCTCGGGCACGCAACTTAACAAGGCGGCCAGCAACGGCGGAGGCCGGCAAGCGCTCGAGCACGCGGCAACGGGT
TCGTCGATGAGTAGCCTGACGACGGTCACTACGTTTGACTCGGAGAGCAAAGTCATCTATCCATTCCGGGTGAAG
CATCTGGGCCACGAGGTGTACACTCTGCACGCCCCGTCGGCGCGGGACCGGCGAGACTGGTGCGTGAGCATCATC
GACGCCAAGACGAGGCACGCCGAGTCTTTGTTCTCGCAGAACGCTGAGCCGTTTCGGCTACGGGTCTTGGCCGAC
GCCTCCTTTCACTACGACGCCAACTCGATATATATGCGCGCCTCGGGCGTGCACGTCAAGGGGACGCCGCTGGAC
AGGGCCATTCAGGAGCTGGAGAGCGTCATGGGCTCGTCCCAGGGCATCGCGCCCGTGTGCCGAGCGCAGGTCAAC
TGTGCGGCGGGCTTCTCGGCGTTTGGGAGGCCGCTGCTGGCCATCGGGACCGACTACGGCATCTTTGTGACCGAC
CCGGCCGAGCCCCGGGGATGGCGTCGGACTGTACAGACAGCGCGGGTGACGCAGATGGCGGTGCTGGAAGAGTTT
TCCGTATGCCTGGCCATCGCGGACAAGTCGCTCGTGTCGTATCCGCTCGACGTCGTGGCGCCCAACTCGGATCTG
GCACCGCCCATGAGCGACAGTCCTCGACGGGCACCGCAGCGGCTGGCCAAGGACGTTACGTACTTTGCCACGGCG
CGGATGAAGGATCGGACGCTCGTCTTTTACAAGCGAAAGGAGGGCCTCCATACGTCGTTCAAGGTGTTGGAGCCC
ATCCTCCACAAGGCTACGGAGAAGCGTTCACGCTTCGGACGGCGGGCGATTGCCCGGAGCACGGACACGTTCCGC
GACTTTGACGAGTTTTACCTGCCAACAGAGTGCTATTCACTCAGCCTGTTTCAGACATACATCGCCGTGGCCACG
GCCAAGGGCGTCGAGATGCTCACGCTGGACAAGAAGCAGCCCATGTCGATCCCGGACCTCAAGGCGCCGGCCATT
GCCAACATTGCCGGGCGTGTCCGTGACCAGCGGCCGCTCGGCATGTTTCGACTCAACGACAGCGAGTTCATCCTA
ACGTACGAGGACTGCGCCGTCTACGTCGACAAGCACGGCGACGTCAGCCGCACCCTCATCATGGAGTACACGGGC
AAGCAGAAAAAGGCCCGGAGCGCGACCATGTACGGCCAGTACCTGCTGCTCTTCAACGACGACTACGTCGAGGTG
CGCAACGCCGACAACGGCCGACTGCGGCAGATTATCGCCGGTCGTGACGTCCGTGTCATCGACTACGGCGTCCGG
GGCCCGACGGGGGGCAACGCCTCGGCGACGCAGGTAAACGGACACGCGCCGGGAGACGTCAGCAAGGGCACCGTC
AAGATCTCCATGTGCCATCCCGAACAGGCGGGGAAGCAGATCGTGCTCGAGATGCTGCTCAACGACGGACACGTG
GATTGA
Gene >Ophcf2|00828
ATGTCGTTCCGCGCCGATGATCAGCGTCGCTACGGCCACGTTCCGCCCGTCCAGTATCCTGTTCCCGGACATCAC
CCCGATCGTCAGGCGGCAGGTCGACGTCTGAGCTTCAACAGCGGTGACGACGCTGCCTACTACGGCCCTCAGTCG
CCCGCTGCACCTCCTCACCATCCCCCCGCCGAGGACGAACTCTTCTTCAACCCGAGCTCCACCAGCCCTTCGGCT
TATGGCTCATCCAACAGCGCCTACCAACGCCAGTATCAGAGCACCACGCCCCGTACGCCCCCGACTCATTCCACC
TACAACCCCCAGGCCTTTTCCACTCCATCCGCCTCGGCCGCTCTGCGAAACTCCCCGTCGGCTGCTCTCCCTCAC
CAGCCGCACTCGTCGCCGCGATACTCAGGCAGCTCCTACGGCACATCTCCTCCGGCTGGTTACGCCCCGCAGGTC
TATAATCCAGCCGCCTACGCCGATACAAATGGCCATCAGCGTCAGCCTGTCCATGCCGGCTATCCTCAAGACCAA
GTCTACGCCGCCGTCCGCGGCCAATCGCCGGCCTCGGCCTATACAGCTGCCTTTCCTCATCAGCTGCCCTCTACC
GGTCAGTCTGCCGGTCAAGCCTTGACCTATGATCCTTCTCAGTATGCCTCGTACGGTGACGCCCAGCCGTCGGCC
TCGCACGCGTCTGTCTCCCACCTCCCGTATCCAACCACGTCGCAAATACCCGTCGGCCCCAACTACCAGGATCAG
CTTTCGTACTTTAGCCGTCCCGTTCGGTCGGACTCGCAGCAGTCATCGCGAGCTTCTCCCTACATGCATCCGCAC
TCGCCTTCTGGTCTCCAGCGGCATCCGACCAATGCCCCCCTTCCCAGCCGGCCGATGAACGAGCCGATGGACGAG
CTTTATTGGGACGTCAATGGTCGGCTCTCGGGCAGGGACCGCAACCTGGAGCTGGTGACGCCCGAGAGCATCATG
GAAGAAATCGAGGCCGAGCTGGGCGAGACCAGTCACAGATCCCGACGGCGTCCATCCCCGATGAACGGCCAGCCG
TCTCATGAGCAGGTCCAGCGGGCGCCGCCTCATGTCCCACCGCACTCTCCCTCGGCGTCTCCGGGCAGAGCTCCG
GTCCACTACGATGACGATGACGACGATGACGACGATGACGACCCTGAAGGGACTGCTGGCGTGCTGGCCATGCGA
CAGGCTGAACTTGACGAGGAGCGGTTCAGCGGCAACGCCTTCATGTACAGCGACTTCCCTGCGCCCTTGCCGGTC
CCCCCCAAAAACCCGTTGCCTCCGCCGCCCGAGCTGCAGGATGCCAGCAGCGACAGCGATTTCGGGAGCAACGTC
GACTTGGGTATCATGAGTGGTGGCCACGCAGGCGACTTGACATATGGCGAGCATGTCGGATCCTTCTCCGGCGCC
CTTTCTTTGCCAGCAGTCACACGGCCGTTGCCGATGCCAACTTACGGGGCCGAGAGCTATGACGAAACGCCTCCC
TTCAACGCTGAGATGGACTATGTCGGTACCGGCGGGTTGCGCGCCCCGAGGGCATCGCGACTGAGTTTCGACGAA
GGCCGGGATGAGAGGGTTTCTATTCACTCGGGAGACTCACGACGGAGCGGTTCTGGGTCGCCCGTCAAGGACGAT
TATCAGGACCTCTTTTACCATCCCGGCCTCTCCAGCAGGCCGTTGCCGGCTCTGCCTCCGGGCCCTGGGTCTGAT
AGCAGCTCGATGCTGTCGGCTCGCAACAGCCTCCATTCGCAGAACCAAAATCAGCACCAGCACTCGCTGAGCGCC
GACGCCCGCTACTACCAGGCCGACGCTCCCGAGGCCTTTTATCAGTCAACATCGCAGCAGATGCTGCAGCCGGAG
AGGTCCATCTCGCTCTCCGGCCACAGTCACACGCCGCAGGTTCAGGCCCCTACTAGATCACGGACGGATGCGACC
GAGGAGCGCAAAAAGATCAGCCGGCAGCAGCAGTTGGCCCTGCAGCAGGGACCGGTACTCTCCGAGCACAACGAG
TCGGGACCCGGCTTCCCTCCCGGTGCCTTTGACAGCATCACGTTGCCGAGCGGGCGCAAGAAGAAGTTTGTGCCG
TCGAAACTGTTGGCATCGGACTTTCGCAAGTGCTCGGAAGCATGGGCACTCAGCGCCGTCGAGGCTTGGGTGCGG
CTGATGGGAGAAGGCGAGATTGATCTCAAAGAGAAGACGGTGGAAGAGGCAGTGACGAACCTGTTTGCCTTTAAG
GTGCCGACGATGAACGTTGCGGATGCCGAGACGCTCAGCAGCCACGTGGTTCGGCTCATGCTCGACTCTGGCCTC
TTGTTACCGGACGAGGAATGGGTCAAGTTTGGCGACGGGCATATATCCGGCATTCTCTGGCAGCTGACCGGTTCG
GGCTGCTACGCCCCCAAGCTTCACGCATTCGAGGCGAGCGGCCACTGCTACTCGCATCTGTGCACGCGTACCGTC
CGCAAGTTTGAGCTGGACGATCTGGAATCGGACGACGCAGAGAAGAAGGAATGGCACGTCTACCACAACCTGAGG
CCGGAGGAGATCAGCGCCAAAGGCGGCAAGGAGGTGGCGCGGCAGAACAACCTGCACGAGATTGTCACGGGCGAA
CATCACTACGTTAAGCAGCTGGATATCTTCCGCAACATCTACCGCGAGAGCCTGCGGAGGCGGCAGCCGCCCATC
ATCCACCCCGAGAAGCAGGCAAAGTTCTTCAACGCCGTCTTTGGCAACATGGACGCCGTATCGGCCGTTCACAAG
CAGCACCTCCTGTCAAGGCTCAGGCACCGTCGGGACGCTCAGGGCCCGTGGATCGTCGGCTTCAGCGACATCTTT
CGCGAGTGGATTCGCAAAGCCAAGTCGGACTACATTGAGTACGCGGCCTGCTATCCGCGGGCCAAGTATCTGCTG
CAGAAGGAGTCGGAGCGCAACGTCTTGTTTCAGAAGTTTAACGAGGAGATGCGCAAGGACAAGGCGTCTTCGAAG
CAGGACTGGACGCATTTCCTGCTCGCCCCCATCCAGCGGCTGCCGCGATACATTCTCCTGCTGGAGACGGTGGAG
AAGAACACGGTGGACGAGAGCGAGGAAAAGACGAACCTGCAGAGGGCCATCCAGGAGATCCGGACGGTGACGATT
GAGTGCGACGCCAAGGTGGCCGAGACGGAGGCGCGGGTGCACATGATGGCGCTGGACCAGATGCTCGTGCTGCGG
CCAGGCTTCCAGTCGGTGCTGAACCTGCACCACCTCGGCAGGGCCCTCATCAAGCAGGGCGAGCTGCAGAGGATG
GGGTCCAAGGGGATGCGTTGGGTCGACACGCACGCCCTGCTGTTCGATCACTACCTGATTCTGTCCAAGGTAGTC
TTCACCAAAGACGGCAGGGCGGAGAAGAAGTTTGACGTTTCGCGCGAGGTGAGTCGTCTGGATCTCGGGGTCTGA
GCCGGAGGGCTTACTGACTGCTCGACAGCCCATCCCGATGCCGCTGCTGCTCCTGGAGAGCATGAATGACGAGCC
GGTGACGAAGCAAAAGGTCATTACGGCGCCTCTGAGCCGGACAACGGCCGCCTCTGCCTCGGGCACGCAACTTAA
CAAGGCGGCCAGCAACGGCGGAGGCCGGCAAGCGCTCGAGCACGCGGCAACGGGTTCGTCGATGAGTAGCCTGAC
GACGGTCACTACGTTTGACTCGGAGAGCAAAGTCATCTATCCATTCCGGGTGAAGCATCTGGGCCACGAGGTGTA
CACTCTGCACGCCCCGTCGGCGCGGGACCGGCGAGACTGGTGCGTGAGCATCATCGACGCCAAGACGAGGCACGC
CGAGTCTTTGTTCTCGCAGAACGCTGAGCCGTTTCGGCTACGGGTCTTGGCCGACGCCTCCTTTCACTACGACGC
CAACTCGATATATATGCGCGCCTCGGGCGTGCACGTCAAGGGGACGCCGCTGGACAGGGCCATTCAGGAGCTGGA
GAGCGTCATGGGCTCGTCCCAGGGCATCGCGCCCGTGTGCCGAGCGCAGGTCAACTGTGCGGCGGGCTTCTCGGC
GTTTGGGAGGCCGCTGCTGGCCATCGGGACCGACTACGGCATCTTTGTGACCGACCCGGCCGAGCCCCGGGGATG
GCGTCGGGTGAGTGGGAGCCCCTACAGCCCCTGTAGCCCCTAATTCAAGAAGCAAAGTTGCTGACGCCCTTTCGA
CACACCAGACTGTACAGACAGCGCGGGTGACGCAGATGGCGGTGCTGGAAGAGTTTTCCGTATGCCTGGCCATCG
CGGACAAGTCGCTCGTGTCGTATCCGCTCGACGTCGTGGCGCCCAACTCGGATCTGGCACCGCCCATGAGCGACA
GTCCTCGACGGGCACCGCAGCGGCTGGCCAAGGACGTTACGTACTTTGCCACGGCGCGGATGAAGGATCGGACGC
TCGTCTTTTACAAGCGAAAGGAGGGCCTCCATACGTCGTTCAAGGTGTTGGAGCCCATCCTCCACAAGGCTACGG
AGAAGCGTTCACGCTTCGGACGGCGGGCGATTGCCCGGAGCACGGACACGTTCCGCGACTTTGACGAGTTTTACC
TGCCAACAGAGTGCTATTCACTCAGCCTGTTTCAGACATACATCGCCGTGGCCACGGCCAAGGGCGTCGAGATGC
TCACGCTGGACAAGAAGCAGCCCATGTCGATCCCGGACCTCAAGGCGCCGGCCATTGCCAACATTGCCGGGCGTG
TCCGTGACCAGCGGCCGCTCGGCATGTTTCGACTCAACGACAGCGAGTTCATCCTAACGTACGAGGACTGCGCCG
TCTACGTCGACAAGCACGGCGACGTCAGCCGCACCCTCATCATGGAGTACACGGGCAAGCAGAAAAAGGCCCGGA
GCGCGACCATGTACGGCCAGTACCTGCTGCTCTTCAACGACGACTACGTCGAGGTGCGCAACGCCGACAACGGCC
GACTGCGGCAGATTATCGCCGGTCGTGACGTCCGTGTCATCGACTACGGCGTCCGGGGCCCGACGGGGGGCAACG
CCTCGGCGACGCAGGTAAACGGACACGCGCCGGGAGACGTCAGCAAGGGCACCGTCAAGATCTCCATGTGCCATC
CCGAACAGGCGGGGAAGCAGATCGTGCTCGAGATGCTGCTCAACGACGGACACGTGGATTGA

© 2023 - Robin Ohm - Utrecht University - The Netherlands

Built with Python Django and Wagtail