Fungal Genomics

at Utrecht University

General Properties

Protein IDOphcf2|00827
Gene name
Locationscaffold_01:3211235..3211864
Strand+
Gene length (bp)629
Transcript length (bp)468
Coding sequence length (bp)468
Protein length (aa) 156

Your browser does not support drawing a protein figure.

PFAM Domains

PFAM Domain ID Short name Long name E-value Start End
PF03650 MPC Mitochondrial pyruvate carriers 7.0E-49 44 150

GO

GO Term Description Terminal node
GO:0006850 mitochondrial pyruvate transmembrane transport Yes
GO:0005743 mitochondrial inner membrane Yes
GO:0005575 cellular_component No
GO:1990542 mitochondrial transmembrane transport No
GO:0051234 establishment of localization No
GO:0110165 cellular anatomical entity No
GO:0009987 cellular process No
GO:0006810 transport No
GO:0071702 organic substance transport No
GO:0019866 organelle inner membrane No
GO:0098656 anion transmembrane transport No
GO:0006848 pyruvate transport No
GO:0034220 ion transmembrane transport No
GO:0015711 organic anion transport No
GO:0031090 organelle membrane No
GO:0051179 localization No
GO:0046942 carboxylic acid transport No
GO:0006820 anion transport No
GO:1905039 carboxylic acid transmembrane transport No
GO:1901475 pyruvate transmembrane transport No
GO:0015718 monocarboxylic acid transport No
GO:0031966 mitochondrial membrane No
GO:0055085 transmembrane transport No
GO:0006811 ion transport No
GO:1903825 organic acid transmembrane transport No
GO:0008150 biological_process No
GO:0015849 organic acid transport No
GO:0016020 membrane No

SignalP

[Help with interpreting these statistics]
SignalP signal predicted Location
(based on Ymax)
D score
(significance: > 0.45)
No 1 - 13 0.45

Transmembrane Domains

Domain # Start End Length
1 110 132 22

Transcription Factor Class

(None)

Expression data

Analysis 1: Expression analysis during behavioral modification. Published in: Will et al., G3, 2020

Click here for more information

Sequences

Type of sequenceSequence
Locus Download genbank file of locus
The gene with 5 kb flanks (if sufficient flanking sequence is available). For use in cloning design programs. NOTE: features (genes or exons) that are only partially contained within the sequence are completely excluded.
Protein >Ophcf2|00827
MLPAASLSRASRPLFRHPPRFRPNARSDSRRWQSGAAGAQQGWFRRMWESEVGFKTVHFWAPVMKWALVLAGISD
FARPAEKLSMPQNFALTCTGLIWTRWCLIIKPKNYLLAAVNFFLGIVGVVQLTRIGIYKSSQNDSPLEKAKKTVE
EKIDS*
Coding >Ophcf2|00827
ATGCTCCCCGCAGCCTCCCTCTCCCGCGCCTCGCGTCCGCTATTCCGTCACCCGCCGCGCTTCCGCCCCAACGCC
CGCTCCGACTCGCGAAGATGGCAGAGCGGCGCGGCCGGCGCTCAACAAGGCTGGTTTAGGCGCATGTGGGAGAGC
GAGGTTGGCTTCAAGACGGTTCATTTCTGGGCTCCCGTCATGAAGTGGGCCCTCGTCCTCGCCGGAATTTCCGAC
TTTGCCCGCCCGGCCGAGAAGCTGTCGATGCCGCAGAACTTTGCCCTCACTTGCACGGGCCTCATCTGGACGCGA
TGGTGTCTCATCATCAAGCCCAAGAACTACCTGCTCGCGGCCGTCAACTTCTTCCTCGGCATCGTTGGCGTCGTC
CAGTTGACTCGCATCGGCATCTACAAGTCGTCGCAAAACGACAGTCCTCTAGAAAAGGCCAAGAAGACTGTCGAG
GAAAAGATCGACTCATAG
Transcript >Ophcf2|00827
ATGCTCCCCGCAGCCTCCCTCTCCCGCGCCTCGCGTCCGCTATTCCGTCACCCGCCGCGCTTCCGCCCCAACGCC
CGCTCCGACTCGCGAAGATGGCAGAGCGGCGCGGCCGGCGCTCAACAAGGCTGGTTTAGGCGCATGTGGGAGAGC
GAGGTTGGCTTCAAGACGGTTCATTTCTGGGCTCCCGTCATGAAGTGGGCCCTCGTCCTCGCCGGAATTTCCGAC
TTTGCCCGCCCGGCCGAGAAGCTGTCGATGCCGCAGAACTTTGCCCTCACTTGCACGGGCCTCATCTGGACGCGA
TGGTGTCTCATCATCAAGCCCAAGAACTACCTGCTCGCGGCCGTCAACTTCTTCCTCGGCATCGTTGGCGTCGTC
CAGTTGACTCGCATCGGCATCTACAAGTCGTCGCAAAACGACAGTCCTCTAGAAAAGGCCAAGAAGACTGTCGAG
GAAAAGATCGACTCATAG
Gene >Ophcf2|00827
ATGCTCCCCGCAGCCTCCCTCTCCCGCGCCTCGCGTCCGCTATTCCGTCACCCGCCGCGCTTCCGCCCCAACGCC
CGCTCCGACTCGCGAAGATGGCAGAGCGGCGCGGCCGGCGCTCAACAAGGCTGGTTTAGGCGCATGTGGGAGAGC
GAGGTTGGCTTCAAGACGGTTCATTTCTGGTGCGCGGAGCCGTCCGTCTCCCCGTCGTCCTGAAACCAATACTGA
TCGTCGCCGTGAATCAGGGCTCCCGTCATGAAGGTCCGTCTGCGCCTCCACCGGTTCACCACTCGCTAACCCCCC
CAGCAGTGGGCCCTCGTCCTCGCCGGAATTTCCGACTTTGCCCGCCCGGCCGAGAAGCTGTCGATGCCGCAGAAC
TTTGCCCTCACTTGCACGGGCCTCATCTGGACGCGATGGTGTCTCATCATCAAGCCCAAGAACTACCTGTTGGTC
CCACCCGGCTTTGACTCTATGCTTGCTCGCTGACCGATGACAGGCTCGCGGCCGTCAACTTCTTCCTCGGCATCG
TTGGCGTCGTCCAGTTGACTCGCATCGGCATCTACAAGTCGTCGCAAAACGACAGTCCTCTAGAAAAGGCCAAGA
AGACTGTCGAGGAAAAGATCGACTCATAG

© 2022 - Robin Ohm - Utrecht University - The Netherlands

Built with Python Django and Wagtail