Fungal Genomics

at Utrecht University

General Properties

Protein IDOphcf2|00816
Gene name
Locationscaffold_01:3187574..3190763
Strand+
Gene length (bp)3189
Transcript length (bp)3021
Coding sequence length (bp)3021
Protein length (aa) 1007

Your browser does not support drawing a protein figure.

PFAM Domains

PFAM Domain ID Short name Long name E-value Start End
PF10337 ArAE_2_N Putative ER transporter, 6TM, N-terminal 4.1E-17 143 428
PF13515 FUSC_2 Fusaric acid resistance protein-like 4.9E-12 628 763
PF10334 ArAE_2 Aromatic acid exporter family member 2 4.4E-06 767 947

GO

(None)

SignalP

[Help with interpreting these statistics]
SignalP signal predicted Location
(based on Ymax)
D score
(significance: > 0.45)
No 1 - 61 0.5

Transmembrane Domains

Domain # Start End Length
1 81 103 22
2 108 130 22
3 143 165 22
4 170 192 22
5 205 227 22
6 602 621 19
7 633 650 17
8 654 676 22
9 681 699 18
10 703 725 22
11 746 768 22

Transcription Factor Class

(None)

Expression data

Analysis 1: Expression analysis during behavioral modification. Published in: Will et al., G3, 2020

Click here for more information

Sequences

Type of sequenceSequence
Locus Download genbank file of locus
The gene with 5 kb flanks (if sufficient flanking sequence is available). For use in cloning design programs. NOTE: features (genes or exons) that are only partially contained within the sequence are completely excluded.
Protein >Ophcf2|00816
MAVWPRTGKRRRRAAKTAEPKPEPKPEPKTRTSPRLAQLKAVLVRLEPDVGSVFMAFKMTIAPLVCICLIQSTAW
TNHYKTNGYLVALIANLALPFLPRGTLIKFNVQLALATAVSYCYVLLAGWCGLQARKHTTHSPEQLKAYNSSAEA
VVAIFLIFCVWTIFSLKSAYPSLFFLLSIAGIYAVSTLPGLARASTIKDVINQSSNVVESFLTGQAFGFFVGIVI
LPRSGRDDFRKAFKGCLDGLVVIVRAHEQCMSVFKARPPDYVPPSPTSTGDEADERAAAATKLQEALKGFTNGVI
KARAAAAHAKLELSFGRLDNRELRQMMSGLIDLVPPASGLFAVADMLKGAIDGSLKADMENEARRRRGTDATLDG
RDEEEDDDGREQEEEATHDWHQLEEAILQHLHNMSEAIVNGVEHAKLRFHLTADKLKLPFLHRNQEESASAPPSP
RPGDENFLESFRGVVERECDVGQGKDGSGGEKLMDHYIRHRPKDEDLSRVTTEKQLDYSQTLLSSLSNELEGLLI
TAEDYYGKPSRLIIPHLGHLDWLKVFRLNRKTTDDSGVELGAGFRKRDPDHVPPVNAFERVGNYIRLIPAALRSE
HAAYGLRGACAIMTIAIVAFLRCSQSFFFRQRLLWALFAIIMSLGRTSGNSNFLLMSRTVGTIASMFASYIIWYI
VDQKTAGIYVFLELWLFFLCYLLLKFPPYSSAIFVAVFTTIIMICNDLQIRKIGASKLETQFTVYPPFVNFPYRL
AIVLLGVATAYFWTVFPFPLSEHGQLRQEVGSSFNLLGNYYSCISQAVISRLEGSFGDPRDEASPGFYILAARRR
IFRKYQTSNTAARSDLGLVDWEFSLGGRFPKKIYGEILSLLDRIASYMTLTGYASRTFQGLSDTSAWRFVDEDDV
TRSQLLIEGVTTRMVVLHSALSQAHPLPPQLRELTRAHMPEFSSEIRSEGVAAAALIHGVNSYIVRDINRLTQLV
KDLVGELDFTVTVETDGEIPLASARNSRPST*
Coding >Ophcf2|00816
ATGGCCGTCTGGCCAAGGACCGGCAAGCGGCGGCGCCGTGCCGCAAAGACGGCCGAGCCCAAGCCCGAGCCCAAG
CCCGAGCCCAAGACCCGGACTTCCCCCCGGCTCGCGCAGCTCAAGGCGGTGCTGGTCCGGCTCGAGCCCGACGTC
GGCAGCGTCTTCATGGCGTTCAAGATGACGATTGCCCCTCTCGTCTGCATATGCCTCATTCAGAGCACCGCATGG
ACGAACCATTATAAGACCAACGGCTACCTGGTGGCTCTCATAGCTAACCTCGCCCTGCCTTTTCTCCCGCGCGGG
ACCCTCATCAAGTTCAACGTCCAGCTGGCGCTGGCCACGGCCGTATCTTACTGCTACGTTCTGCTCGCCGGCTGG
TGTGGACTCCAGGCGCGCAAGCATACGACGCATAGCCCCGAGCAGCTCAAGGCCTACAACTCGTCTGCTGAGGCC
GTAGTTGCCATCTTTCTCATCTTTTGCGTCTGGACCATCTTCAGCCTCAAATCGGCCTATCCTTCCCTCTTCTTC
CTCCTCTCCATTGCGGGCATCTATGCCGTGTCCACATTGCCTGGACTGGCGCGAGCTTCGACCATCAAGGACGTC
ATCAACCAATCCAGCAACGTCGTCGAGAGCTTCCTGACCGGTCAGGCATTTGGCTTCTTCGTCGGCATCGTCATC
CTGCCCAGAAGCGGAAGGGATGACTTCCGAAAGGCCTTCAAGGGCTGCCTCGATGGCCTCGTCGTCATCGTTCGA
GCCCATGAGCAATGCATGAGCGTCTTCAAGGCCAGACCACCAGACTACGTACCACCGTCACCGACGTCTACGGGA
GACGAAGCCGACGAGAGGGCTGCGGCGGCGACGAAGCTGCAGGAGGCACTCAAGGGCTTCACCAACGGCGTCATC
AAGGCGCGCGCCGCGGCCGCCCATGCCAAGCTCGAGCTGTCCTTTGGTCGGCTGGATAACCGGGAGCTCCGACAG
ATGATGTCCGGGCTGATCGATCTCGTGCCGCCGGCTTCCGGCTTGTTCGCCGTCGCTGACATGCTCAAGGGGGCA
ATCGACGGCTCCCTAAAGGCCGATATGGAGAATGAAGCAAGGAGACGACGAGGTACAGATGCCACACTCGATGGA
CGAGACGAGGAGGAAGATGATGATGGGCGAGAACAAGAGGAGGAAGCTACCCACGACTGGCATCAACTCGAAGAA
GCCATCCTCCAACATCTGCACAACATGTCCGAGGCGATAGTCAACGGGGTAGAGCACGCCAAGTTGCGCTTCCAC
TTGACCGCCGACAAGCTCAAGCTTCCTTTTCTTCACAGGAACCAGGAAGAAAGCGCGAGTGCTCCGCCTTCACCC
CGTCCGGGAGACGAGAACTTCCTCGAATCGTTTCGCGGCGTCGTCGAGCGAGAGTGTGACGTCGGTCAGGGAAAA
GACGGTTCGGGCGGCGAGAAGCTGATGGATCATTACATTCGTCATCGGCCTAAAGACGAGGACCTGAGTCGTGTC
ACGACGGAGAAGCAGCTTGACTACTCTCAAACCCTCCTATCTTCCCTCTCAAACGAGCTCGAAGGCCTTCTCATC
ACCGCCGAAGACTACTACGGAAAGCCCTCACGGCTCATCATCCCACACCTTGGCCATCTCGACTGGCTCAAGGTG
TTTCGCCTCAATCGCAAGACGACGGATGACTCCGGCGTCGAGCTCGGCGCAGGCTTTCGAAAGAGGGACCCGGAT
CACGTACCGCCGGTCAACGCCTTCGAGAGGGTCGGAAACTACATCAGGCTCATACCGGCAGCCTTGCGATCCGAA
CACGCAGCATATGGGCTACGAGGAGCATGTGCCATCATGACCATCGCTATAGTCGCTTTTCTGAGATGTTCCCAA
TCCTTCTTCTTCAGACAGCGCTTGCTATGGGCCCTCTTCGCCATTATAATGTCTCTGGGACGGACTTCGGGGAAT
TCCAACTTCCTCCTGATGAGCCGCACAGTCGGAACCATAGCTTCAATGTTCGCCAGCTACATCATCTGGTATATC
GTCGATCAGAAGACGGCGGGTATCTATGTCTTTCTCGAGCTATGGCTGTTCTTCCTCTGCTACTTACTTCTCAAA
TTCCCTCCCTACTCCAGCGCCATCTTCGTCGCCGTGTTTACCACCATCATCATGATCTGTAACGATCTACAGATT
AGAAAGATTGGCGCCTCGAAGCTCGAGACTCAGTTCACCGTCTACCCTCCCTTCGTAAACTTCCCATACAGATTG
GCCATCGTCTTGTTAGGCGTCGCTACTGCTTACTTCTGGACCGTCTTTCCCTTTCCTCTGAGCGAACATGGCCAA
CTCCGTCAAGAGGTTGGCAGTTCCTTTAACCTCCTGGGCAACTACTACTCCTGCATCAGCCAGGCCGTCATCTCC
CGCTTGGAGGGCAGCTTTGGCGATCCACGAGACGAGGCCAGCCCCGGCTTTTACATCCTCGCCGCTCGTCGCCGC
ATCTTTCGCAAATATCAGACCAGCAACACCGCCGCTCGCTCGGATCTTGGCCTCGTCGACTGGGAGTTTTCTCTC
GGCGGCAGGTTCCCCAAGAAAATCTACGGCGAGATACTATCTCTTCTCGACCGCATAGCGAGCTACATGACCCTC
ACGGGCTACGCTTCCCGGACCTTCCAAGGCCTGTCAGACACTTCAGCCTGGCGCTTTGTCGACGAGGACGACGTC
ACACGCTCTCAACTACTGATTGAAGGCGTCACCACCCGCATGGTCGTCCTTCACTCGGCCCTGAGCCAGGCTCAT
CCCCTGCCTCCCCAACTTCGAGAGCTGACCCGAGCTCATATGCCCGAGTTCTCCAGCGAGATCAGAAGCGAAGGC
GTGGCCGCTGCGGCCCTCATTCACGGCGTCAACTCGTACATAGTCCGTGATATAAATCGGCTCACGCAGCTCGTC
AAAGATCTCGTCGGAGAGCTGGACTTTACCGTCACCGTCGAGACTGACGGCGAGATTCCGCTCGCCTCTGCTAGA
AACTCTCGGCCGTCGACATGA
Transcript >Ophcf2|00816
ATGGCCGTCTGGCCAAGGACCGGCAAGCGGCGGCGCCGTGCCGCAAAGACGGCCGAGCCCAAGCCCGAGCCCAAG
CCCGAGCCCAAGACCCGGACTTCCCCCCGGCTCGCGCAGCTCAAGGCGGTGCTGGTCCGGCTCGAGCCCGACGTC
GGCAGCGTCTTCATGGCGTTCAAGATGACGATTGCCCCTCTCGTCTGCATATGCCTCATTCAGAGCACCGCATGG
ACGAACCATTATAAGACCAACGGCTACCTGGTGGCTCTCATAGCTAACCTCGCCCTGCCTTTTCTCCCGCGCGGG
ACCCTCATCAAGTTCAACGTCCAGCTGGCGCTGGCCACGGCCGTATCTTACTGCTACGTTCTGCTCGCCGGCTGG
TGTGGACTCCAGGCGCGCAAGCATACGACGCATAGCCCCGAGCAGCTCAAGGCCTACAACTCGTCTGCTGAGGCC
GTAGTTGCCATCTTTCTCATCTTTTGCGTCTGGACCATCTTCAGCCTCAAATCGGCCTATCCTTCCCTCTTCTTC
CTCCTCTCCATTGCGGGCATCTATGCCGTGTCCACATTGCCTGGACTGGCGCGAGCTTCGACCATCAAGGACGTC
ATCAACCAATCCAGCAACGTCGTCGAGAGCTTCCTGACCGGTCAGGCATTTGGCTTCTTCGTCGGCATCGTCATC
CTGCCCAGAAGCGGAAGGGATGACTTCCGAAAGGCCTTCAAGGGCTGCCTCGATGGCCTCGTCGTCATCGTTCGA
GCCCATGAGCAATGCATGAGCGTCTTCAAGGCCAGACCACCAGACTACGTACCACCGTCACCGACGTCTACGGGA
GACGAAGCCGACGAGAGGGCTGCGGCGGCGACGAAGCTGCAGGAGGCACTCAAGGGCTTCACCAACGGCGTCATC
AAGGCGCGCGCCGCGGCCGCCCATGCCAAGCTCGAGCTGTCCTTTGGTCGGCTGGATAACCGGGAGCTCCGACAG
ATGATGTCCGGGCTGATCGATCTCGTGCCGCCGGCTTCCGGCTTGTTCGCCGTCGCTGACATGCTCAAGGGGGCA
ATCGACGGCTCCCTAAAGGCCGATATGGAGAATGAAGCAAGGAGACGACGAGGTACAGATGCCACACTCGATGGA
CGAGACGAGGAGGAAGATGATGATGGGCGAGAACAAGAGGAGGAAGCTACCCACGACTGGCATCAACTCGAAGAA
GCCATCCTCCAACATCTGCACAACATGTCCGAGGCGATAGTCAACGGGGTAGAGCACGCCAAGTTGCGCTTCCAC
TTGACCGCCGACAAGCTCAAGCTTCCTTTTCTTCACAGGAACCAGGAAGAAAGCGCGAGTGCTCCGCCTTCACCC
CGTCCGGGAGACGAGAACTTCCTCGAATCGTTTCGCGGCGTCGTCGAGCGAGAGTGTGACGTCGGTCAGGGAAAA
GACGGTTCGGGCGGCGAGAAGCTGATGGATCATTACATTCGTCATCGGCCTAAAGACGAGGACCTGAGTCGTGTC
ACGACGGAGAAGCAGCTTGACTACTCTCAAACCCTCCTATCTTCCCTCTCAAACGAGCTCGAAGGCCTTCTCATC
ACCGCCGAAGACTACTACGGAAAGCCCTCACGGCTCATCATCCCACACCTTGGCCATCTCGACTGGCTCAAGGTG
TTTCGCCTCAATCGCAAGACGACGGATGACTCCGGCGTCGAGCTCGGCGCAGGCTTTCGAAAGAGGGACCCGGAT
CACGTACCGCCGGTCAACGCCTTCGAGAGGGTCGGAAACTACATCAGGCTCATACCGGCAGCCTTGCGATCCGAA
CACGCAGCATATGGGCTACGAGGAGCATGTGCCATCATGACCATCGCTATAGTCGCTTTTCTGAGATGTTCCCAA
TCCTTCTTCTTCAGACAGCGCTTGCTATGGGCCCTCTTCGCCATTATAATGTCTCTGGGACGGACTTCGGGGAAT
TCCAACTTCCTCCTGATGAGCCGCACAGTCGGAACCATAGCTTCAATGTTCGCCAGCTACATCATCTGGTATATC
GTCGATCAGAAGACGGCGGGTATCTATGTCTTTCTCGAGCTATGGCTGTTCTTCCTCTGCTACTTACTTCTCAAA
TTCCCTCCCTACTCCAGCGCCATCTTCGTCGCCGTGTTTACCACCATCATCATGATCTGTAACGATCTACAGATT
AGAAAGATTGGCGCCTCGAAGCTCGAGACTCAGTTCACCGTCTACCCTCCCTTCGTAAACTTCCCATACAGATTG
GCCATCGTCTTGTTAGGCGTCGCTACTGCTTACTTCTGGACCGTCTTTCCCTTTCCTCTGAGCGAACATGGCCAA
CTCCGTCAAGAGGTTGGCAGTTCCTTTAACCTCCTGGGCAACTACTACTCCTGCATCAGCCAGGCCGTCATCTCC
CGCTTGGAGGGCAGCTTTGGCGATCCACGAGACGAGGCCAGCCCCGGCTTTTACATCCTCGCCGCTCGTCGCCGC
ATCTTTCGCAAATATCAGACCAGCAACACCGCCGCTCGCTCGGATCTTGGCCTCGTCGACTGGGAGTTTTCTCTC
GGCGGCAGGTTCCCCAAGAAAATCTACGGCGAGATACTATCTCTTCTCGACCGCATAGCGAGCTACATGACCCTC
ACGGGCTACGCTTCCCGGACCTTCCAAGGCCTGTCAGACACTTCAGCCTGGCGCTTTGTCGACGAGGACGACGTC
ACACGCTCTCAACTACTGATTGAAGGCGTCACCACCCGCATGGTCGTCCTTCACTCGGCCCTGAGCCAGGCTCAT
CCCCTGCCTCCCCAACTTCGAGAGCTGACCCGAGCTCATATGCCCGAGTTCTCCAGCGAGATCAGAAGCGAAGGC
GTGGCCGCTGCGGCCCTCATTCACGGCGTCAACTCGTACATAGTCCGTGATATAAATCGGCTCACGCAGCTCGTC
AAAGATCTCGTCGGAGAGCTGGACTTTACCGTCACCGTCGAGACTGACGGCGAGATTCCGCTCGCCTCTGCTAGA
AACTCTCGGCCGTCGACATGA
Gene >Ophcf2|00816
ATGGCCGTCTGGCCAAGGACCGGCAAGCGGCGGCGCCGTGCCGCAAAGACGGCCGAGCCCAAGCCCGAGCCCAAG
CCCGAGCCCAAGACCCGGACTTCCCCCCGGCTCGCGCAGCTCAAGGCGGTGCTGGTCCGGCTCGAGCCCGACGTC
GGCAGCGTCTTCATGGCGTTCAAGATGACGATTGCCCCTCTCGTCTGCATATGCCTCATTCAGAGCACCGCATGG
ACGAACCATTATAAGACCAACGGCTACCTGGTGGCTCTCATAGCTAACCTCGCCCTGCCTTTTCTCCCGCGCGGG
ACCCTCATCAAGTTCAACGTCCAGCTGGCGCTGGCCACGGCCGTATCTTACTGCTACGTTCTGCTCGCCGGCTGG
TGTGGACTCCAGGCGCGCAAGCATACGACGCATAGCCCCGAGCAGCTCAAGGCCTACAACTCGTCTGCTGAGGCC
GTAGTTGCCATCTTTCTCATCTTTTGCGTCTGGACCATCTTCAGCCTCAAATCGGCCTATCCTTCCCTCTTCTTC
CTCCTCTCCATTGCGGGCATCTATGCCGTGTCCACATTGCCTGGACTGGCGCGAGCTTCGACCATCAAGGACGTC
ATCAACCAATCCAGCAACGTCGTCGAGAGCTTCCTGACCGGTCAGGCATTTGGCTTCTTCGTCGGCATCGTCATC
CTGCCCAGAAGCGGAAGGGATGACTTCCGAAAGGCCTTCAAGGGCTGCCTCGATGGCCTCGTCGTCATCGTTCGA
GCCCATGAGCAATGCATGAGCGTCTTCAAGGCCAGACCACCAGACTACGTACCACCGTCACCGACGTCTACGGGA
GACGAAGCCGACGAGAGGGCTGCGGCGGCGACGAAGCTGCAGGAGGCACTCAAGGGCTTCACCAACGGCGTCATC
AAGGCGCGCGCCGCGGCCGCCCATGCCAAGCTCGAGCTGTCCTTTGGTCGGCTGGATAACCGGGAGCTCCGACAG
ATGATGTCCGGGCTGATCGATCTCGTGCCGCCGGCTTCCGGCTTGTTCGCCGTCGCTGACATGCTCAAGGGGGCA
ATCGACGGCTCCCTAAAGGCCGATATGGAGAATGAAGCAAGGAGACGACGAGGTACAGATGCCACACTCGATGGA
CGAGACGAGGAGGAAGATGATGATGGGCGAGAACAAGAGGAGGAAGCTACCCACGACTGGCATCAACTCGAAGAA
GCCATCCTCCAACATCTGCACAACATGTCCGAGGCGATAGTCAACGGGGTAGAGCACGCCAAGTTGCGCTTCCAC
TTGACCGCCGACAAGCTCAAGCTTCCTTTTCTTCACAGGAACCAGGAAGAAAGCGCGAGTGCTCCGCCTTCACCC
CGTCCGGGAGACGAGAACTTCCTCGAATCGTTTCGCGGCGTCGTCGAGCGAGAGTGTGACGTCGGTCAGGGAAAA
GACGGTTCGGGCGGCGAGAAGCTGATGGATCATTACATTCGTCATCGGCCTAAAGACGAGGACCTGAGTCGTGTC
ACGACGGAGAAGCAGCTTGACTACGTGAGATACGTCCTACTCCTGCATGTAAAGCCTCCCGTCAACTCATCCTGC
ATACATGTACATGAGAGCCAACTGACAAGGCTACAAAGTCTCAAACCCTCCTATCTTCCCTCTCAAACGAGCTCG
AAGGCCTTCTCATCACCGCCGAAGACTACTACGGAAAGCCCTCACGGCTCATCATCCCACACCTTGGCCATCTCG
ACTGGCTCAAGGTGTTTCGCCTCAATCGCAAGACGACGGATGACTCCGGCGTCGAGCTCGGCGCAGGCTTTCGAA
AGAGGGACCCGGATCACGTACCGCCGGTCAACGCCTTCGAGAGGGTCGGAAACTACATCAGGCTCATACCGGCAG
CCTTGCGATCCGAACACGCAGCATATGGGCTACGAGGAGCATGTGCCATCATGACCATCGCTATAGTCGCTTTTC
TGAGATGTTCCCAATCCTTCTTCTTCAGACAGCGCTTGCTATGGGCCCTCTTCGCCATTATAATGTCTCTGGGAC
GGACTTCGGGGAATTCCAACTTCCTCCTGATGAGCCGCACAGTCGGAACCATAGCTTCAATGTTCGCCAGCTACA
TCATCTGGTATATCGTCGATCAGAAGACGGCGGGTATCTATGTCTTTCTCGAGCTATGGCTGTTCTTCCTCTGCT
ACTTACGTATGTACGACCATCTCTCCCCTTTCTTCATCAAACATCGATCGAGTCTCGTTTACTTACATGATACGT
GCGTCAAAAGTTCTCAAATTCCCTCCCTACTCCAGCGCCATCTTCGTCGCCGTGTTTACCACCATCATCATGATC
TGTAACGATCTACAGATTAGAAAGATTGGCGCCTCGAAGCTCGAGACTCAGTTCACCGTCTACCCTCCCTTCGTA
AACTTCCCATACAGATTGGCCATCGTCTTGTTAGGCGTCGCTACTGCTTACTTCTGGACCGTCTTTCCCTTTCCT
CTGAGCGAACATGGCCAACTCCGTCAAGAGGTTGGCAGTTCCTTTAACCTCCTGGGCAACTACTACTCCTGCATC
AGCCAGGCCGTCATCTCCCGCTTGGAGGGCAGCTTTGGCGATCCACGAGACGAGGCCAGCCCCGGCTTTTACATC
CTCGCCGCTCGTCGCCGCATCTTTCGCAAATATCAGACCAGCAACACCGCCGCTCGCTCGGATCTTGGCCTCGTC
GACTGGGAGTTTTCTCTCGGCGGCAGGTTCCCCAAGAAAATCTACGGCGAGATACTATCTCTTCTCGACCGCATA
GCGAGCTACATGACCCTCACGGGCTACGCTTCCCGGACCTTCCAAGGCCTGTCAGACACTTCAGCCTGGCGCTTT
GTCGACGAGGACGACGTCACACGCTCTCAACTACTGATTGAAGGCGTCACCACCCGCATGGTCGTCCTTCACTCG
GCCCTGAGCCAGGCTCATCCCCTGCCTCCCCAACTTCGAGAGCTGACCCGAGCTCATATGCCCGAGTTCTCCAGC
GAGATCAGAAGCGAAGGCGTGGCCGCTGCGGCCCTCATTCACGGCGTCAACTCGTACATAGTCCGTGATATAAAT
CGGCTCACGCAGCTCGTCAAAGATCTCGTCGGAGAGCTGGACTTTACCGTCACCGTCGAGACTGACGGCGAGATT
CCGCTCGCCTCTGCTAGAAACTCTCGGCCGTCGACATGA

© 2022 - Robin Ohm - Utrecht University - The Netherlands

Built with Python Django and Wagtail