Fungal Genomics

at Utrecht University

General Properties

Protein IDOphcf2|00811
Gene name
Locationscaffold_01:3178768..3181007
Strand+
Gene length (bp)2239
Transcript length (bp)2124
Coding sequence length (bp)2124
Protein length (aa) 708

Overview

Your browser does not support drawing a protein figure.

PFAM Domains

PFAM Domain ID Short name Long name E-value Start End
PF02786 CPSase_L_D2 Carbamoyl-phosphate synthase L chain, ATP binding domain 2.4E-73 136 346
PF00289 Biotin_carb_N Biotin carboxylase, N-terminal domain 2.2E-34 27 131
PF02785 Biotin_carb_C Biotin carboxylase C-terminal domain 3.8E-34 364 472
PF00364 Biotin_lipoyl Biotin-requiring enzyme 3.4E-13 637 700
PF07478 Dala_Dala_lig_C D-ala D-ala ligase C-terminus 1.1E-07 163 315
PF02222 ATP-grasp ATP-grasp domain 2.7E-07 152 316

GO

GO Term Description Terminal node
GO:0005524 ATP binding Yes
GO:0008716 D-alanine-D-alanine ligase activity Yes
GO:0032553 ribonucleotide binding No
GO:0097159 organic cyclic compound binding No
GO:0043168 anion binding No
GO:1901363 heterocyclic compound binding No
GO:0005488 binding No
GO:0032559 adenyl ribonucleotide binding No
GO:1901265 nucleoside phosphate binding No
GO:0003824 catalytic activity No
GO:0016874 ligase activity No
GO:0003674 molecular_function No
GO:0016881 acid-amino acid ligase activity No
GO:0017076 purine nucleotide binding No
GO:0032555 purine ribonucleotide binding No
GO:0000166 nucleotide binding No
GO:0036094 small molecule binding No
GO:0043167 ion binding No
GO:0030554 adenyl nucleotide binding No
GO:0016879 ligase activity, forming carbon-nitrogen bonds No
GO:0097367 carbohydrate derivative binding No
GO:0035639 purine ribonucleoside triphosphate binding No

Deeploc

[Help with interpreting the results of Deeploc 2.0]
Localizations Signals Cytoplasm Nucleus Extracellular Cell membrane Mitochondrion Plastid Endoplasmic reticulum Lysosome vacuole Golgi apparatus Peroxisome
Mitochondrion Mitochondrial transit peptide 0.1608 0.1022 0.0764 0.0428 0.9397 0.0439 0.0652 0.0426 0.0751 0.0095

SignalP

(None)

Transmembrane Domains

(None)

Transcription Factor Class

(None)

CAZymes

(None)

Secondary Metabolism

(None)

Expression data

Analysis 1: Expression analysis during behavioral modification. Published in: Will et al., G3, 2020

Click here for more information

Orthologs

Orthofinder run ID4
Orthogroup4658
Change Orthofinder run
Species Protein ID
Ophiocordyceps australis 1348a (Ghana) OphauG2|2960
Ophiocordyceps australis map64 (Brazil) OphauB2|3126
Ophiocordyceps camponoti-floridani Ophcf2|00811 (this protein)
Ophiocordyceps camponoti-rufipedis Ophun1|1756
Ophiocordyceps kimflemingae Ophio5|6455
Ophiocordyceps subramaniannii Hirsu2|9824

Sequences

Type of sequenceSequence
Locus Download genbank file of locus Download genbank file of locus (reverse complement)
The gene with 5 kb flanks (if sufficient flanking sequence is available). For use in cloning design programs. NOTE: features (genes or exons) that are only partially contained within the sequence are completely excluded.
Protein >Ophcf2|00811
MRSVRTRGLRSAWALRRLNSTSCRALESVLIANRGEIALRINRTAERMGIRATTVYTDVDADAWHASAGFRSLGL
GTANGYLDGDKMIALAKRHGIQALHPGYGFLSENAQFARRCEDEGIVFVGPPASAMADMGDKARSKEIMTAANVP
CVPGYHGSEQGEHQLRRHAEAVGFPVLLKSVRGGGGKGMRIVAGAQEFATQLKSARAEARASFGEGGEVMLVEKY
IVRPRHVEVQIFADRHGNTVALGERDCSIQRRHQKMLEESPAPDLDDGTRQDLWEKARKAASAVGYVGAGTVEFI
LDKDSGRFYFMEMNTRLQVEHPVTEMVTGLDLVEWQFRIAAGETLPLDQAEVEARMRTRGSAIEARVYAEDPDRA
FMPDSGKLVRAELTGADDDDVRLDRGFGTGSVVSEAYDGMIAKLIVRGDSRRQAVAKLEAALRKFEIVGVSTNVE
FLKRVCSTPAFIEGDVETGFVDKWRDHLFAEMAVPPEVYAQAALGILGRERLRQGRAAPANGESLGFGDAAERTV
TLRVVGRGEGEEEEEAQVGIKQTGRGRFDVTVEGKDEPIVFKDVLSSSTLTTVQSRFPSEKIASTVVLRDSDLDS
EKTRLTVFQHGVKWELQLVPPKWFEDALGLKEVTASVAAPMPCKVLKIEVAEGETVMKGDPLVVIESMKMETLIR
APKKSIVKKLPHKEGDICKAGTILVFFEEEDG*
Coding >Ophcf2|00811
ATGCGTTCTGTCCGGACTCGTGGCCTTCGCTCTGCCTGGGCGCTGCGACGGCTCAACTCGACCAGTTGCAGGGCG
CTCGAGTCGGTTCTCATCGCCAACCGAGGCGAGATTGCGTTACGAATCAACCGCACGGCGGAGCGGATGGGGATC
CGGGCAACGACGGTCTATACAGACGTTGACGCCGACGCATGGCACGCCTCGGCCGGCTTTCGATCTCTGGGCCTC
GGAACGGCCAACGGATACCTCGACGGCGATAAGATGATTGCGCTGGCCAAGAGACACGGCATCCAGGCGCTCCAT
CCAGGCTATGGCTTCCTATCGGAGAATGCGCAGTTCGCGCGTCGGTGCGAGGACGAGGGCATCGTCTTTGTCGGC
CCACCAGCGTCTGCCATGGCCGACATGGGCGACAAGGCGCGCAGCAAGGAGATAATGACGGCCGCAAACGTCCCC
TGCGTACCGGGATATCACGGCTCCGAGCAAGGGGAGCATCAGCTGCGACGACATGCCGAGGCCGTGGGCTTCCCC
GTGCTGCTCAAGAGCGTTCGCGGAGGCGGCGGCAAGGGCATGCGCATCGTGGCCGGCGCCCAAGAGTTTGCGACG
CAGCTCAAGAGCGCGCGAGCCGAAGCGAGGGCTTCGTTCGGTGAAGGCGGCGAGGTGATGCTGGTTGAAAAGTAC
ATCGTTCGGCCGCGGCATGTCGAGGTGCAGATCTTTGCTGACCGTCACGGCAATACGGTGGCCCTGGGCGAACGA
GACTGCAGCATCCAGCGAAGGCATCAGAAGATGTTGGAGGAATCTCCTGCGCCGGATCTCGACGACGGGACTCGG
CAGGATTTGTGGGAAAAGGCCCGGAAGGCGGCATCGGCGGTGGGTTACGTCGGCGCCGGTACGGTCGAGTTCATC
CTCGACAAGGACAGCGGACGCTTCTATTTCATGGAGATGAATACGCGGCTTCAGGTCGAGCATCCGGTCACGGAG
ATGGTGACGGGTCTGGATCTGGTGGAGTGGCAGTTCCGCATCGCCGCCGGGGAGACTCTTCCCCTGGACCAGGCC
GAAGTCGAAGCCCGGATGCGGACGCGCGGCTCGGCCATTGAAGCCCGCGTCTACGCCGAGGATCCGGACAGAGCC
TTCATGCCGGACTCGGGCAAGCTGGTGAGGGCCGAACTGACGGGGGCCGACGATGATGACGTCCGGCTGGACCGG
GGGTTCGGAACGGGAAGCGTCGTGTCCGAAGCCTACGACGGCATGATTGCGAAACTCATCGTACGAGGCGACTCT
CGACGCCAGGCCGTGGCCAAACTCGAGGCAGCACTGCGAAAGTTTGAGATTGTGGGCGTCAGCACCAACGTCGAG
TTTCTCAAACGCGTCTGCAGCACGCCAGCCTTTATAGAAGGCGATGTCGAGACGGGCTTCGTCGACAAGTGGCGC
GACCATCTCTTCGCCGAGATGGCTGTCCCCCCTGAGGTGTACGCCCAGGCGGCCCTCGGCATCTTGGGACGCGAG
CGGCTACGTCAGGGGAGAGCCGCGCCGGCCAACGGGGAGAGTCTCGGCTTCGGTGACGCGGCTGAGCGGACTGTC
ACGCTGCGAGTCGTCGGTCGAGGAGAGGGAGAGGAGGAGGAGGAAGCGCAGGTGGGCATCAAGCAGACGGGCCGA
GGCCGGTTCGATGTTACCGTCGAAGGAAAGGATGAGCCGATTGTCTTTAAAGACGTGCTCAGCTCATCGACGCTC
ACGACGGTACAATCTCGTTTCCCCTCTGAGAAAATCGCCTCGACCGTCGTTCTACGTGACTCCGACTTGGACTCT
GAGAAGACGAGATTAACCGTGTTTCAACATGGCGTCAAATGGGAGCTCCAGCTCGTGCCTCCCAAGTGGTTCGAG
GACGCGCTCGGTCTCAAAGAGGTGACTGCCTCTGTTGCGGCGCCGATGCCGTGCAAGGTGTTGAAGATTGAGGTT
GCTGAAGGGGAGACGGTCATGAAGGGGGATCCTCTGGTCGTCATCGAAAGCATGAAGATGGAAACGCTCATTCGC
GCCCCAAAGAAGTCTATAGTGAAGAAGCTTCCGCACAAGGAGGGGGATATCTGCAAGGCGGGCACGATACTTGTC
TTTTTCGAGGAGGAGGATGGATGA
Transcript >Ophcf2|00811
ATGCGTTCTGTCCGGACTCGTGGCCTTCGCTCTGCCTGGGCGCTGCGACGGCTCAACTCGACCAGTTGCAGGGCG
CTCGAGTCGGTTCTCATCGCCAACCGAGGCGAGATTGCGTTACGAATCAACCGCACGGCGGAGCGGATGGGGATC
CGGGCAACGACGGTCTATACAGACGTTGACGCCGACGCATGGCACGCCTCGGCCGGCTTTCGATCTCTGGGCCTC
GGAACGGCCAACGGATACCTCGACGGCGATAAGATGATTGCGCTGGCCAAGAGACACGGCATCCAGGCGCTCCAT
CCAGGCTATGGCTTCCTATCGGAGAATGCGCAGTTCGCGCGTCGGTGCGAGGACGAGGGCATCGTCTTTGTCGGC
CCACCAGCGTCTGCCATGGCCGACATGGGCGACAAGGCGCGCAGCAAGGAGATAATGACGGCCGCAAACGTCCCC
TGCGTACCGGGATATCACGGCTCCGAGCAAGGGGAGCATCAGCTGCGACGACATGCCGAGGCCGTGGGCTTCCCC
GTGCTGCTCAAGAGCGTTCGCGGAGGCGGCGGCAAGGGCATGCGCATCGTGGCCGGCGCCCAAGAGTTTGCGACG
CAGCTCAAGAGCGCGCGAGCCGAAGCGAGGGCTTCGTTCGGTGAAGGCGGCGAGGTGATGCTGGTTGAAAAGTAC
ATCGTTCGGCCGCGGCATGTCGAGGTGCAGATCTTTGCTGACCGTCACGGCAATACGGTGGCCCTGGGCGAACGA
GACTGCAGCATCCAGCGAAGGCATCAGAAGATGTTGGAGGAATCTCCTGCGCCGGATCTCGACGACGGGACTCGG
CAGGATTTGTGGGAAAAGGCCCGGAAGGCGGCATCGGCGGTGGGTTACGTCGGCGCCGGTACGGTCGAGTTCATC
CTCGACAAGGACAGCGGACGCTTCTATTTCATGGAGATGAATACGCGGCTTCAGGTCGAGCATCCGGTCACGGAG
ATGGTGACGGGTCTGGATCTGGTGGAGTGGCAGTTCCGCATCGCCGCCGGGGAGACTCTTCCCCTGGACCAGGCC
GAAGTCGAAGCCCGGATGCGGACGCGCGGCTCGGCCATTGAAGCCCGCGTCTACGCCGAGGATCCGGACAGAGCC
TTCATGCCGGACTCGGGCAAGCTGGTGAGGGCCGAACTGACGGGGGCCGACGATGATGACGTCCGGCTGGACCGG
GGGTTCGGAACGGGAAGCGTCGTGTCCGAAGCCTACGACGGCATGATTGCGAAACTCATCGTACGAGGCGACTCT
CGACGCCAGGCCGTGGCCAAACTCGAGGCAGCACTGCGAAAGTTTGAGATTGTGGGCGTCAGCACCAACGTCGAG
TTTCTCAAACGCGTCTGCAGCACGCCAGCCTTTATAGAAGGCGATGTCGAGACGGGCTTCGTCGACAAGTGGCGC
GACCATCTCTTCGCCGAGATGGCTGTCCCCCCTGAGGTGTACGCCCAGGCGGCCCTCGGCATCTTGGGACGCGAG
CGGCTACGTCAGGGGAGAGCCGCGCCGGCCAACGGGGAGAGTCTCGGCTTCGGTGACGCGGCTGAGCGGACTGTC
ACGCTGCGAGTCGTCGGTCGAGGAGAGGGAGAGGAGGAGGAGGAAGCGCAGGTGGGCATCAAGCAGACGGGCCGA
GGCCGGTTCGATGTTACCGTCGAAGGAAAGGATGAGCCGATTGTCTTTAAAGACGTGCTCAGCTCATCGACGCTC
ACGACGGTACAATCTCGTTTCCCCTCTGAGAAAATCGCCTCGACCGTCGTTCTACGTGACTCCGACTTGGACTCT
GAGAAGACGAGATTAACCGTGTTTCAACATGGCGTCAAATGGGAGCTCCAGCTCGTGCCTCCCAAGTGGTTCGAG
GACGCGCTCGGTCTCAAAGAGGTGACTGCCTCTGTTGCGGCGCCGATGCCGTGCAAGGTGTTGAAGATTGAGGTT
GCTGAAGGGGAGACGGTCATGAAGGGGGATCCTCTGGTCGTCATCGAAAGCATGAAGATGGAAACGCTCATTCGC
GCCCCAAAGAAGTCTATAGTGAAGAAGCTTCCGCACAAGGAGGGGGATATCTGCAAGGCGGGCACGATACTTGTC
TTTTTCGAGGAGGAGGATGGATGA
Gene >Ophcf2|00811
ATGCGTTCTGTCCGGACTCGTGGCCTTCGCTCTGCCTGGGCGCTGCGACGGCTCAACTCGACCAGTTGCAGGGCG
CTCGAGTCGGTTCTCATCGCCAACCGAGGCGAGATTGCGTTACGAATCAACCGCACGGCGGAGCGGATGGGGATC
CGGGCAACGACGGTCTATACAGACGTTGACGCCGACGCATGGCACGCCTCGGCCGGCTTTCGATCTCTGGGCCTC
GGAACGGCCAACGGATACCTCGACGGCGATAAGATGATTGCGCTGGCCAAGAGACACGGCATCCAGGCGCTCCAT
CCAGGCTATGGCTTCCTATCGGAGAATGCGCAGTTCGCGCGTCGGTGCGAGGACGAGGGCATCGTCTTTGTCGGC
CCACCAGCGTCTGCCATGGCCGACATGGGCGACAAGGCGCGCAGCAAGGAGATAATGACGGCCGCAAACGTCCCC
TGCGTACCGGGATATCACGGCTCCGAGCAAGGGGAGCATCAGCTGCGACGACATGCCGAGGCCGTGGGCTTCCCC
GTGCTGCTCAAGAGCGTTCGCGGAGGCGGCGGCAAGGGCATGCGCATCGTGGCCGGCGCCCAAGAGTTTGCGACG
CAGCTCAAGAGCGCGCGAGCCGAAGCGAGGGCTTCGTTCGGTGAAGGCGGCGAGGTGATGCTGGTTGAAAAGTAC
ATCGTTCGGCCGCGGCATGTCGAGGTGCAGATCTTTGCTGACCGTCACGGCAATACGGTGGCCCTGGGCGAACGA
GACTGCAGCATCCAGCGAAGGCATCAGAAGATGTTGGAGGAATCTCCTGCGCCGGATCTCGACGACGGGACTCGG
CAGGATTTGTGGGAAAAGGCCCGGAAGGCGGCATCGGCGGTGGGTTACGTCGGCGCCGGTACGGTCGAGTTCATC
CTCGACAAGGACAGCGGACGCTTCTATTTCATGGAGATGAATACGCGGCTTCAGGTCGAGCATCCGGTCACGGAG
ATGGTGACGGGTCTGGATCTGGTGGAGTGGCAGTTCCGCATCGCCGCCGGGGAGACTCTTCCCCTGGACCAGGCC
GAAGTCGAAGCCCGGATGCGGACGCGCGGCTCGGCCATTGAAGCCCGCGTCTACGCCGAGGATCCGGACAGAGCC
TTCATGCCGGACTCGGGCAAGCTGGTGAGGGCCGAACTGACGGGGGCCGACGATGATGACGTCCGGCTGGACCGG
GGGTTCGGAACGGGAAGCGTCGTGTCCGAAGCCTACGACGGCATGATTGCGAAACTCATCGTACGAGGCGACTCT
CGACGCCAGGCCGTGGCCAAACTCGAGGCAGCACTGCGAAAGTTTGAGATTGTGGGCGTCAGCACCAACGTCGAG
TTTCTCAAACGCGTCTGCAGCACGCCAGCCTTTATAGAAGGCGATGTCGAGACGGGCTTCGTCGACAAGTGGCGC
GACCATCTCTTCGCCGAGATGGCTGTCCCCCCTGAGGTGTACGCCCAGGCGGCCCTCGGCATCTTGGGACGCGAG
CGGCTACGTCAGGGGAGAGCCGCGCCGGCCAACGGGGAGAGTCTCGGCTTCGGTGACGCGGCTGAGCGGACTGTC
ACGCTGCGAGTCGTCGGTCGAGGAGAGGGAGAGGAGGAGGAGGAAGCGCAGGTGGGCATCAAGCAGACGGGCCGA
GGCCGGTTCGATGTTACCGTCGAAGGAAAGGATGAGCCGATTGTCTTTAAAGACGTGCTCAGCTCATCGACGCTC
ACGACGGTACAATCTCGTTTCCCCTCTGAGAAAATCGCCTCGACCGTCGTTCTACGTGACTCCGACTTGGACTCT
GAGAAGACGAGATTAACCGTGTTTCAACATGGCGTCAAATGGGAGCTCCAGCTCGTGCCTCCCAAGTGGTTCGAG
GACGCGCTCGGTCTCAAAGAGGTGACTGCCTCTGTTGCGGCGCCGATGCCGTGCAAGGTGTTGAAGATTGAGGTT
GCTGAAGGGGAGACGGTCATGAAGGGGGATCCTCTGGTCGTGTAAGTGAAGTCGAGCGCAAGGCTTGACGAGGCT
AACGCTCCATATCAGCATCGAAAGCATGAAGATGGAAACGCTCATTCGCGCCCCAAAGAAGTCTATAGTGAAGAA
GCTTCCGCACAAGGAGGGGGTAAGTTCTTTCTTTGAACCATGCATCTCACGGACCCATTTACATGTACTCACGGG
TGAAACGTAGGATATCTGCAAGGCGGGCACGATACTTGTCTTTTTCGAGGAGGAGGATGGATGA

© 2023 - Robin Ohm - Utrecht University - The Netherlands

Built with Python Django and Wagtail