Fungal Genomics

at Utrecht University

General Properties

Protein IDOphcf2|00810
Gene name
Locationscaffold_01:3177678..3178452
Strand-
Gene length (bp)774
Transcript length (bp)660
Coding sequence length (bp)660
Protein length (aa) 220

Overview

Your browser does not support drawing a protein figure.

PFAM Domains

PFAM Domain ID Short name Long name E-value Start End
PF01243 Putative_PNPOx Pyridoxamine 5'-phosphate oxidase 1.7E-10 23 96

GO

(None)

Deeploc

[Help with interpreting the results of Deeploc 2.0]
Localizations Signals Cytoplasm Nucleus Extracellular Cell membrane Mitochondrion Plastid Endoplasmic reticulum Lysosome vacuole Golgi apparatus Peroxisome
Cytoplasm|Nucleus Peroxisomal targeting signal 0.5014 0.5831 0.062 0.023 0.6031 0.0754 0.0845 0.1952 0.0265 0.5933

SignalP

(None)

Transmembrane Domains

(None)

Transcription Factor Class

(None)

CAZymes

(None)

Secondary Metabolism

(None)

Expression data

Analysis 1: Expression analysis during behavioral modification. Published in: Will et al., G3, 2020

Click here for more information

Orthologs

Orthofinder run ID4
Orthogroup4659
Change Orthofinder run
Species Protein ID
Ophiocordyceps australis 1348a (Ghana) OphauG2|2961
Ophiocordyceps australis map64 (Brazil) OphauB2|5030
Ophiocordyceps camponoti-floridani Ophcf2|00810 (this protein)
Ophiocordyceps camponoti-rufipedis Ophun1|1755
Ophiocordyceps kimflemingae Ophio5|6453
Ophiocordyceps subramaniannii Hirsu2|9825

Sequences

Type of sequenceSequence
Locus Download genbank file of locus Download genbank file of locus (reverse complement)
The gene with 5 kb flanks (if sufficient flanking sequence is available). For use in cloning design programs. NOTE: features (genes or exons) that are only partially contained within the sequence are completely excluded.
Protein >Ophcf2|00810
MDKIPLNYEASQGDTHRQMTHALPPEVVQCLENARFLHFATCTDNVPHVSLMNYTYLPSSPYSTRPVIVLTTNPA
SRKTTSILSNPNVSLLVHDWVSHRPPTSGRRPSVGSPVPEPRSNLAALLLNLNTSAISSISATISGAARLAPEGS
DQEKFYLDTHLANNTFDEGQQETGANSHFVAGEEVRVIVVDIKDVRISDWKGTVRDWSLIPESGVNGAP*
Coding >Ophcf2|00810
ATGGACAAGATACCGCTCAACTACGAGGCCTCTCAGGGCGACACTCACCGGCAGATGACCCACGCTCTGCCTCCA
GAAGTGGTTCAATGCCTCGAAAACGCCCGATTCCTTCACTTCGCTACCTGCACCGACAATGTTCCCCACGTCTCC
CTCATGAACTACACTTACCTCCCGTCTTCGCCCTACTCGACTCGTCCCGTCATCGTCCTGACCACGAACCCTGCC
TCCCGCAAGACTACGAGCATCCTCTCAAATCCAAACGTCTCCCTGCTCGTCCACGATTGGGTCTCTCATCGCCCC
CCGACTTCCGGCCGCCGCCCCTCCGTCGGCTCCCCCGTCCCCGAGCCTCGCTCCAATCTGGCGGCCCTTCTCCTG
AACCTCAACACGTCCGCCATCTCCAGTATAAGCGCCACCATCAGCGGCGCCGCCAGACTCGCTCCCGAGGGATCC
GACCAAGAAAAGTTCTATCTCGACACTCACCTGGCCAACAATACTTTTGACGAGGGACAGCAAGAGACCGGCGCC
AACAGCCATTTTGTCGCCGGCGAAGAGGTCAGAGTCATAGTCGTCGATATCAAGGACGTTCGGATCAGCGATTGG
AAGGGCACCGTCAGAGACTGGTCCTTGATACCCGAGTCGGGTGTCAACGGGGCACCCTGA
Transcript >Ophcf2|00810
ATGGACAAGATACCGCTCAACTACGAGGCCTCTCAGGGCGACACTCACCGGCAGATGACCCACGCTCTGCCTCCA
GAAGTGGTTCAATGCCTCGAAAACGCCCGATTCCTTCACTTCGCTACCTGCACCGACAATGTTCCCCACGTCTCC
CTCATGAACTACACTTACCTCCCGTCTTCGCCCTACTCGACTCGTCCCGTCATCGTCCTGACCACGAACCCTGCC
TCCCGCAAGACTACGAGCATCCTCTCAAATCCAAACGTCTCCCTGCTCGTCCACGATTGGGTCTCTCATCGCCCC
CCGACTTCCGGCCGCCGCCCCTCCGTCGGCTCCCCCGTCCCCGAGCCTCGCTCCAATCTGGCGGCCCTTCTCCTG
AACCTCAACACGTCCGCCATCTCCAGTATAAGCGCCACCATCAGCGGCGCCGCCAGACTCGCTCCCGAGGGATCC
GACCAAGAAAAGTTCTATCTCGACACTCACCTGGCCAACAATACTTTTGACGAGGGACAGCAAGAGACCGGCGCC
AACAGCCATTTTGTCGCCGGCGAAGAGGTCAGAGTCATAGTCGTCGATATCAAGGACGTTCGGATCAGCGATTGG
AAGGGCACCGTCAGAGACTGGTCCTTGATACCCGAGTCGGGTGTCAACGGGGCACCCTGA
Gene >Ophcf2|00810
ATGGACAAGATACCGCTCAACTACGAGGCCTCTCAGGGCGACACTCACCGGCAGATGACCCACGCTCTGCCTCCA
GAAGTGGTTCAATGCCTCGAAAACGCCCGATTCGTACGTACAACAGGTGGACGAGGCCTACGCTCAACTTACGCT
CAGCTTGCGCTCTCAGCTTCACTTCGCTACCTGCACCGACAATGTTCCCCACGTCTCCCTCATGAACTACACTTA
CCTCCCGTCTTCGCCCTACTCGACTCGTCCCGTCATCGTCCTGACCACGAACCCTGCCTCCCGCAAGACTACGAG
CATCCTCTCAAATCCAAACGTCTCCCTGCTCGTCCACGATTGTCTGTCCGCGCATCTAGATCTATATAGATCCGT
ACAGCTTCCGCTGACAATCTAGGGGTCTCTCATCGCCCCCCGACTTCCGGCCGCCGCCCCTCCGTCGGCTCCCCC
GTCCCCGAGCCTCGCTCCAATCTGGCGGCCCTTCTCCTGAACCTCAACACGTCCGCCATCTCCAGTATAAGCGCC
ACCATCAGCGGCGCCGCCAGACTCGCTCCCGAGGGATCCGACCAAGAAAAGTTCTATCTCGACACTCACCTGGCC
AACAATACTTTTGACGAGGGACAGCAAGAGACCGGCGCCAACAGCCATTTTGTCGCCGGCGAAGAGGTCAGAGTC
ATAGTCGTCGATATCAAGGACGTTCGGATCAGCGATTGGAAGGGCACCGTCAGAGACTGGTCCTTGATACCCGAG
TCGGGTGTCAACGGGGCACCCTGA

© 2023 - Robin Ohm - Utrecht University - The Netherlands

Built with Python Django and Wagtail