Fungal Genomics

at Utrecht University

General Properties

Protein IDOphcf2|00800
Gene name
Locationscaffold_01:3149548..3151459
Strand-
Gene length (bp)1911
Transcript length (bp)1797
Coding sequence length (bp)1797
Protein length (aa) 599

Overview

Your browser does not support drawing a protein figure.

PFAM Domains

PFAM Domain ID Short name Long name E-value Start End
PF00704 Glyco_hydro_18 Glycosyl hydrolases family 18 9.5E-16 14 299

GO

GO Term Description Terminal node
GO:0005975 carbohydrate metabolic process Yes
GO:0071704 organic substance metabolic process No
GO:0044238 primary metabolic process No
GO:0008152 metabolic process No
GO:0008150 biological_process No

Deeploc

[Help with interpreting the results of Deeploc 2.0]
Localizations Signals Cytoplasm Nucleus Extracellular Cell membrane Mitochondrion Plastid Endoplasmic reticulum Lysosome vacuole Golgi apparatus Peroxisome
Extracellular 0.1925 0.1313 0.7495 0.4374 0.0604 0.0154 0.2959 0.1276 0.1249 0.0036

SignalP

(None)

Transmembrane Domains

(None)

Transcription Factor Class

(None)

CAZymes

CAZyme category E-value Start End
GH18 5.9E-19 37 263

Secondary Metabolism

(None)

Expression data

Analysis 1: Expression analysis during behavioral modification. Published in: Will et al., G3, 2020

Click here for more information

Orthologs

Orthofinder run ID4
Orthogroup175
Change Orthofinder run
Species Protein ID
Ophiocordyceps australis 1348a (Ghana) OphauG2|6129
Ophiocordyceps australis 1348a (Ghana) OphauG2|7112
Ophiocordyceps australis map64 (Brazil) OphauB2|5114
Ophiocordyceps australis map64 (Brazil) OphauB2|5509
Ophiocordyceps camponoti-floridani Ophcf2|00800 (this protein)
Ophiocordyceps camponoti-floridani Ophcf2|05574
Ophiocordyceps camponoti-rufipedis Ophun1|1902
Ophiocordyceps camponoti-rufipedis Ophun1|7604
Ophiocordyceps kimflemingae Ophio5|2615
Ophiocordyceps kimflemingae Ophio5|6743
Ophiocordyceps subramaniannii Hirsu2|242
Ophiocordyceps subramaniannii Hirsu2|7599

Sequences

Type of sequenceSequence
Locus Download genbank file of locus Download genbank file of locus (reverse complement)
The gene with 5 kb flanks (if sufficient flanking sequence is available). For use in cloning design programs. NOTE: features (genes or exons) that are only partially contained within the sequence are completely excluded.
Protein >Ophcf2|00800
MALASSSACGVLNGYWGQTSGPDLRTFCDGGIQYATLGFVNMAPENDRSKSGFPGINFSSHCWAGAFPGSVGDTT
QLLSHCESIKNDIPYCQAKGVKIILSIGGEYRKPQGAADSSSDYKVSSNGNGEYFADFLYGAFGPFSESWKGPRP
FDAVDKHVAVDGFDFDIEAMFDNEPYIAMINKFRSLDSKLLITGAPQCPTNPQYFQMQGMIQKAAFDALFIQFYN
NPVCDTLGNGFNLEEWTRVVARSEKSKDAKLFIGLPASPKAAGSGYIGPAEVGKLIRKYKDTKNFGGISLWDLKD
AVDNVLEGKTYLAHVLDALGSGCGPELSSTAAYPSSTAAYSPAVVHSLSPAVYSTATAVYSSSVAPLHCVSDSTG
VTETVYPTSRSYQLLPSNTILPASMAKDGDATTTVTRRVFTTKTVSTTTRVHVVTYSAGFTSCRDGELTKETMPL
NTPVGAASTSSSSSLAVELSSHTGSPRLAPSPETRTTYASYASPCLANKTVTKVVTRSSTVYSERTTTYRHPSSP
SSSLDHLLRPAASSGCRTPASVLNCRNCSSFAASKPPFRPRVVSPPPVTAAASRLMWSLAALAVVAAGQLWAA*
Coding >Ophcf2|00800
ATGGCCCTCGCCAGCAGCTCCGCCTGCGGTGTCCTCAACGGCTACTGGGGACAGACGTCAGGCCCAGACCTTCGC
ACCTTTTGTGACGGTGGAATTCAATATGCCACGCTCGGCTTCGTCAACATGGCGCCGGAGAACGATAGGTCCAAG
TCTGGCTTCCCGGGAATCAACTTCTCAAGTCACTGCTGGGCCGGTGCGTTCCCCGGCAGCGTGGGCGATACGACG
CAGCTGCTCAGCCACTGCGAATCCATCAAGAATGACATCCCCTACTGCCAGGCCAAGGGCGTCAAGATCATCCTC
AGCATCGGCGGTGAGTATCGGAAGCCTCAGGGCGCGGCCGATAGCTCGAGCGATTATAAAGTGTCGTCGAATGGG
AATGGCGAGTATTTTGCAGACTTTCTGTATGGGGCTTTTGGGCCCTTTTCCGAGAGCTGGAAGGGGCCCAGGCCG
TTTGATGCGGTGGATAAGCACGTTGCTGTTGATGGATTCGACTTTGATATCGAGGCCATGTTTGACAATGAACCA
TACATTGCCATGATCAACAAGTTTCGTTCACTCGACAGCAAGTTGCTCATCACCGGCGCCCCCCAGTGTCCTACC
AACCCGCAATACTTCCAGATGCAAGGCATGATCCAAAAAGCCGCCTTCGACGCCCTCTTCATCCAGTTCTACAAC
AACCCAGTCTGCGACACCCTCGGCAACGGCTTCAATCTCGAAGAATGGACTCGGGTCGTGGCACGTAGCGAAAAG
AGCAAAGACGCCAAGCTGTTCATAGGCCTGCCAGCGTCGCCCAAGGCTGCTGGCAGCGGCTATATCGGTCCGGCC
GAGGTCGGGAAGCTGATCCGCAAGTACAAGGACACCAAGAACTTCGGCGGCATCTCGCTTTGGGATCTGAAGGAT
GCGGTTGATAATGTCTTGGAGGGCAAGACGTATTTGGCTCATGTCTTGGACGCGCTCGGGTCAGGGTGCGGGCCT
GAACTGTCGTCTACGGCTGCCTATCCATCGTCTACGGCTGCCTATTCGCCTGCAGTTGTCCATTCTTTGTCTCCG
GCTGTCTATTCTACGGCAACGGCTGTCTATTCGTCGTCTGTTGCACCGTTGCATTGCGTCTCGGACAGCACAGGC
GTTACGGAGACTGTCTATCCGACGTCTCGTTCATATCAGCTTTTGCCGTCGAACACGATCCTCCCTGCAAGCATG
GCAAAGGATGGTGATGCCACGACGACTGTCACGAGACGCGTCTTTACGACTAAGACTGTGTCCACCACCACCAGG
GTCCATGTTGTTACCTATTCAGCCGGGTTCACCAGCTGCCGAGACGGGGAGCTTACAAAGGAGACGATGCCTCTG
AACACGCCAGTGGGAGCAGCCTCTACTTCGTCGTCGTCTTCGCTGGCTGTAGAGCTAAGCTCGCACACGGGTAGC
CCTCGGCTTGCTCCCAGCCCCGAGACTAGAACGACCTACGCGTCCTATGCTTCGCCTTGTCTCGCAAACAAGACC
GTTACCAAAGTAGTCACGCGTTCGAGCACCGTCTACAGCGAGAGAACAACAACATATCGACACCCATCGTCTCCA
TCCAGCTCCCTCGACCATCTCCTCCGGCCCGCCGCCTCCTCCGGCTGCCGAACTCCGGCCTCGGTGCTGAACTGC
CGGAACTGCAGCAGCTTCGCCGCATCGAAGCCCCCGTTCCGGCCGAGGGTCGTGTCCCCGCCTCCCGTTACTGCA
GCGGCATCGCGGCTGATGTGGAGTCTAGCTGCTTTGGCTGTCGTTGCTGCTGGACAGCTGTGGGCGGCCTAA
Transcript >Ophcf2|00800
ATGGCCCTCGCCAGCAGCTCCGCCTGCGGTGTCCTCAACGGCTACTGGGGACAGACGTCAGGCCCAGACCTTCGC
ACCTTTTGTGACGGTGGAATTCAATATGCCACGCTCGGCTTCGTCAACATGGCGCCGGAGAACGATAGGTCCAAG
TCTGGCTTCCCGGGAATCAACTTCTCAAGTCACTGCTGGGCCGGTGCGTTCCCCGGCAGCGTGGGCGATACGACG
CAGCTGCTCAGCCACTGCGAATCCATCAAGAATGACATCCCCTACTGCCAGGCCAAGGGCGTCAAGATCATCCTC
AGCATCGGCGGTGAGTATCGGAAGCCTCAGGGCGCGGCCGATAGCTCGAGCGATTATAAAGTGTCGTCGAATGGG
AATGGCGAGTATTTTGCAGACTTTCTGTATGGGGCTTTTGGGCCCTTTTCCGAGAGCTGGAAGGGGCCCAGGCCG
TTTGATGCGGTGGATAAGCACGTTGCTGTTGATGGATTCGACTTTGATATCGAGGCCATGTTTGACAATGAACCA
TACATTGCCATGATCAACAAGTTTCGTTCACTCGACAGCAAGTTGCTCATCACCGGCGCCCCCCAGTGTCCTACC
AACCCGCAATACTTCCAGATGCAAGGCATGATCCAAAAAGCCGCCTTCGACGCCCTCTTCATCCAGTTCTACAAC
AACCCAGTCTGCGACACCCTCGGCAACGGCTTCAATCTCGAAGAATGGACTCGGGTCGTGGCACGTAGCGAAAAG
AGCAAAGACGCCAAGCTGTTCATAGGCCTGCCAGCGTCGCCCAAGGCTGCTGGCAGCGGCTATATCGGTCCGGCC
GAGGTCGGGAAGCTGATCCGCAAGTACAAGGACACCAAGAACTTCGGCGGCATCTCGCTTTGGGATCTGAAGGAT
GCGGTTGATAATGTCTTGGAGGGCAAGACGTATTTGGCTCATGTCTTGGACGCGCTCGGGTCAGGGTGCGGGCCT
GAACTGTCGTCTACGGCTGCCTATCCATCGTCTACGGCTGCCTATTCGCCTGCAGTTGTCCATTCTTTGTCTCCG
GCTGTCTATTCTACGGCAACGGCTGTCTATTCGTCGTCTGTTGCACCGTTGCATTGCGTCTCGGACAGCACAGGC
GTTACGGAGACTGTCTATCCGACGTCTCGTTCATATCAGCTTTTGCCGTCGAACACGATCCTCCCTGCAAGCATG
GCAAAGGATGGTGATGCCACGACGACTGTCACGAGACGCGTCTTTACGACTAAGACTGTGTCCACCACCACCAGG
GTCCATGTTGTTACCTATTCAGCCGGGTTCACCAGCTGCCGAGACGGGGAGCTTACAAAGGAGACGATGCCTCTG
AACACGCCAGTGGGAGCAGCCTCTACTTCGTCGTCGTCTTCGCTGGCTGTAGAGCTAAGCTCGCACACGGGTAGC
CCTCGGCTTGCTCCCAGCCCCGAGACTAGAACGACCTACGCGTCCTATGCTTCGCCTTGTCTCGCAAACAAGACC
GTTACCAAAGTAGTCACGCGTTCGAGCACCGTCTACAGCGAGAGAACAACAACATATCGACACCCATCGTCTCCA
TCCAGCTCCCTCGACCATCTCCTCCGGCCCGCCGCCTCCTCCGGCTGCCGAACTCCGGCCTCGGTGCTGAACTGC
CGGAACTGCAGCAGCTTCGCCGCATCGAAGCCCCCGTTCCGGCCGAGGGTCGTGTCCCCGCCTCCCGTTACTGCA
GCGGCATCGCGGCTGATGTGGAGTCTAGCTGCTTTGGCTGTCGTTGCTGCTGGACAGCTGTGGGCGGCCTAA
Gene >Ophcf2|00800
ATGGCCCTCGCCAGCAGCTCCGCCTGCGGTGTCCTCAACGGCTACTGGGTTCGTTCCCCAAGCCTCTCTCTCGTG
GCATTCTTCATACTGACCTCCTCCCAGGGACAGACGTCAGGCCCAGACCTTCGCACCTTTTGTGACGGTGGAATT
CAATATGCCACGCTCGGCTTCGTCAACATGGCGCCGGAGAACGATAGGTCCAAGTCTGGCTTCCCGGGAATCAAC
TTCTCAAGTCACTGCTGGGCCGGTGCGTTCCCCGGCAGCGTGGGCGATACGACGCAGCTGCTCAGCCACTGCGAA
TCCATCAAGAATGACATCCCCTACTGCCAGGCCAAGGGCGTCAAGATCATCCTCAGCATCGGCGGTGAGTATCGG
AAGCCTCAGGGCGCGGCCGATAGCTCGAGCGATTATAAAGTGTCGTCGAATGGGAATGGCGAGTATTTTGCAGAC
TTTCTGTATGGGGCTTTTGGGCCCTTTTCCGAGAGCTGGAAGGGGCCCAGGCCGTTTGATGCGGTGGATAAGCAC
GTTGCTGTTGATGGATTCGACTTTGATATCGAGGCCATGTTTGGTGAGTTGACTTTGCTATGTCTACGGGACTGA
GTCCGGATGCTGATGCTTAGAGCAACAGACAATGAACCATACATTGCCATGATCAACAAGTTTCGTTCACTCGAC
AGCAAGTTGCTCATCACCGGCGCCCCCCAGTGTCCTACCAACCCGCAATACTTCCAGATGCAAGGCATGATCCAA
AAAGCCGCCTTCGACGCCCTCTTCATCCAGTTCTACAACAACCCAGTCTGCGACACCCTCGGCAACGGCTTCAAT
CTCGAAGAATGGACTCGGGTCGTGGCACGTAGCGAAAAGAGCAAAGACGCCAAGCTGTTCATAGGCCTGCCAGCG
TCGCCCAAGGCTGCTGGCAGCGGCTATATCGGTCCGGCCGAGGTCGGGAAGCTGATCCGCAAGTACAAGGACACC
AAGAACTTCGGCGGCATCTCGCTTTGGGATCTGAAGGATGCGGTTGATAATGTCTTGGAGGGCAAGACGTATTTG
GCTCATGTCTTGGACGCGCTCGGGTCAGGGTGCGGGCCTGAACTGTCGTCTACGGCTGCCTATCCATCGTCTACG
GCTGCCTATTCGCCTGCAGTTGTCCATTCTTTGTCTCCGGCTGTCTATTCTACGGCAACGGCTGTCTATTCGTCG
TCTGTTGCACCGTTGCATTGCGTCTCGGACAGCACAGGCGTTACGGAGACTGTCTATCCGACGTCTCGTTCATAT
CAGCTTTTGCCGTCGAACACGATCCTCCCTGCAAGCATGGCAAAGGATGGTGATGCCACGACGACTGTCACGAGA
CGCGTCTTTACGACTAAGACTGTGTCCACCACCACCAGGGTCCATGTTGTTACCTATTCAGCCGGGTTCACCAGC
TGCCGAGACGGGGAGCTTACAAAGGAGACGATGCCTCTGAACACGCCAGTGGGAGCAGCCTCTACTTCGTCGTCG
TCTTCGCTGGCTGTAGAGCTAAGCTCGCACACGGGTAGCCCTCGGCTTGCTCCCAGCCCCGAGACTAGAACGACC
TACGCGTCCTATGCTTCGCCTTGTCTCGCAAACAAGACCGTTACCAAAGTAGTCACGCGTTCGAGCACCGTCTAC
AGCGAGAGAACAACAACATATCGACACCCATCGTCTCCATCCAGCTCCCTCGACCATCTCCTCCGGCCCGCCGCC
TCCTCCGGCTGCCGAACTCCGGCCTCGGTGCTGAACTGCCGGAACTGCAGCAGCTTCGCCGCATCGAAGCCCCCG
TTCCGGCCGAGGGTCGTGTCCCCGCCTCCCGTTACTGCAGCGGCATCGCGGCTGATGTGGAGTCTAGCTGCTTTG
GCTGTCGTTGCTGCTGGACAGCTGTGGGCGGCCTAA

© 2023 - Robin Ohm - Utrecht University - The Netherlands

Built with Python Django and Wagtail