Fungal Genomics

at Utrecht University

General Properties

Protein IDOphcf2|00799
Gene name
Locationscaffold_01:3145173..3148955
Strand-
Gene length (bp)3782
Transcript length (bp)3657
Coding sequence length (bp)3657
Protein length (aa) 1219

Overview

Your browser does not support drawing a protein figure.

PFAM Domains

PFAM Domain ID Short name Long name E-value Start End
PF01237 Oxysterol_BP Oxysterol-binding protein 6.7E-135 821 1197
PF13857 Ank_5 Ankyrin repeats (many copies) 1.1E-08 153 209
PF12796 Ank_2 Ankyrin repeats (3 copies) 6.9E-10 127 194
PF13637 Ank_4 Ankyrin repeats (many copies) 2.1E-09 134 188
PF00023 Ank Ankyrin repeat 8.1E-05 167 193
PF13606 Ank_3 Ankyrin repeat 3.0E-05 167 193
PF00169 PH PH domain 3.3E-11 367 459
PF15409 PH_8 Pleckstrin homology domain 1.4E-07 372 457

GO

GO Term Description Terminal node
GO:0005515 protein binding Yes
GO:0008289 lipid binding Yes
GO:0005488 binding No
GO:0003674 molecular_function No

Deeploc

[Help with interpreting the results of Deeploc 2.0]
Localizations Signals Cytoplasm Nucleus Extracellular Cell membrane Mitochondrion Plastid Endoplasmic reticulum Lysosome vacuole Golgi apparatus Peroxisome
Cytoplasm 0.5969 0.3514 0.0441 0.3854 0.0859 0.0278 0.6086 0.3698 0.4027 0.0222

SignalP

(None)

Transmembrane Domains

(None)

Transcription Factor Class

(None)

CAZymes

(None)

Secondary Metabolism

(None)

Expression data

Analysis 1: Expression analysis during behavioral modification. Published in: Will et al., G3, 2020

Click here for more information

Orthologs

Orthofinder run ID4
Orthogroup2018
Change Orthofinder run
Species Protein ID
Ophiocordyceps australis 1348a (Ghana) OphauG2|1807
Ophiocordyceps australis map64 (Brazil) OphauB2|5113
Ophiocordyceps camponoti-floridani Ophcf2|00799 (this protein)
Ophiocordyceps camponoti-rufipedis Ophun1|1903
Ophiocordyceps kimflemingae Ophio5|6744
Ophiocordyceps subramaniannii Hirsu2|2277

Sequences

Type of sequenceSequence
Locus Download genbank file of locus Download genbank file of locus (reverse complement)
The gene with 5 kb flanks (if sufficient flanking sequence is available). For use in cloning design programs. NOTE: features (genes or exons) that are only partially contained within the sequence are completely excluded.
Protein >Ophcf2|00799
MSDAADSSHRRSMSAAALSLLRRKDTREDDSGSEDGIKSPRKLSSHQHASRTSTSIARSVPQPPPQLKPVADKTA
SLEQSMRKFRVVEALRSGDTASISRAMRDTADPDRRHSTASLSNLSSGPGPGPGPLRDTTVLHLAIQCAELPVVE
YVLSNGVGIDVNARDKDGNTPLHVAAINGRTPVVKMLLDHKEINDAVANAHTKLPIDVARNPEIFQLLQLSRSLF
AEAKVTQIQELVARKDYAGLSRVLEEPRLKTVLDINSPEFASEPVTIRSGGTLLHEAARQKDTRLIETLLLHGGD
PFRRDRKGKLPQSVTSDDGVKSILKNSPAAVAAQRGIQEKAVLGHAASHVVSPTGPADLMAGKEAREIKGYLKKW
TNYRKGYQLRWFVLEDGVLSYYKHQDDAGSACRGAINMRIAKLHMSADEKTKFEIIGKSSVKYTLKANHEVEAKR
WFWALNNSIQWTKDQAKEEERRASRTAEYLKHAKVDTGGSLSAHDSLNENTSMSELQKTYSHAPSRSPSHAPSRS
LSHARTGSVGDEDEDDERFTGLGTEGDAGSRAPGPTTLAGDHADDDDDYDEKSVRVEPGATKDALNITAQSARLQ
LETMTAVHAALQAELSQSPATPLSDVKVTQALSTYDAATHSLTGLVGDLLRISRDRDAYWQYRLDREANVRRMWE
ESMQRVAREQEELEARMGETESKRRLTKKALKEVMISGAGASANATPTVEKPQAEAEVDARPLGRRATALDQLGE
LSESESEAGDEFFDAVDAGEVEVEPLPADERIDEADGVVVSGVDISSSFKGYENGIRHRLKMDADDRPKVSLWGI
LKSMIGKDMTKMTLPVSFNEPTSLLYRCGEDMEYADLLDRAVERADSIERLIYVAAFAASEYASTIGRVAKPFNP
LLGETFEYVRPDKNYRFFIEQVSHHPPIGAAWAESPHWTYWGESAVRSKFYGKSFDINPLGTWFLRLRPKAGGRE
DLYTWKKVTSSVIGIITGNPTVDNYGPMEIKNWTTGEVAHVDFKPRGWKASSAYQVVGRIVDADGQVRFSMGGRW
NSKLYARLTPGYEATVEEPKDGGGDFGSGGLTDPNRAYLVWEAHERPTGIPFNLTPFVLTFNHIDDKLRPWLPPT
DSRLRPDQRAMEDGEYDVAAEEKNRLEERQRDRRREREARGEEFVPAWFTRDRCAVTGEEYWKFNGKYWEQRDKA
GPAGDADKAWAGLEPIFS*
Coding >Ophcf2|00799
ATGTCGGACGCGGCTGATAGCTCTCACCGGCGCTCCATGTCGGCTGCTGCCCTCTCGCTGCTTCGCCGCAAGGAT
ACGCGAGAGGATGACTCCGGTTCCGAAGACGGCATCAAGTCCCCCCGGAAGCTTTCCTCGCACCAGCATGCCTCG
AGGACGTCAACCAGTATTGCTCGATCGGTGCCGCAGCCGCCGCCGCAACTGAAACCCGTCGCCGACAAGACGGCG
AGTCTGGAACAGTCGATGCGCAAGTTTCGCGTCGTCGAGGCTCTGCGGAGCGGCGACACAGCTTCCATCTCGAGG
GCCATGCGAGACACGGCCGACCCCGACCGCCGTCACAGCACTGCCTCCTTGTCCAACCTCAGCTCCGGCCCCGGC
CCCGGCCCGGGTCCTCTTCGGGATACTACCGTTCTGCATCTAGCTATTCAGTGCGCCGAGCTGCCCGTGGTCGAG
TATGTGCTCTCCAACGGCGTTGGCATCGATGTCAATGCCCGAGACAAGGACGGGAATACGCCCTTGCACGTGGCC
GCCATCAACGGCCGAACGCCCGTCGTCAAGATGCTCCTCGACCACAAAGAAATCAACGATGCCGTCGCAAACGCT
CATACCAAGCTGCCCATCGACGTGGCTCGTAACCCCGAAATCTTTCAGCTCCTGCAACTGTCACGCTCTCTTTTC
GCCGAGGCAAAGGTGACACAGATCCAGGAGCTCGTGGCTCGCAAGGACTACGCCGGCCTCTCGCGCGTGTTGGAG
GAGCCCCGGCTCAAGACGGTGCTCGACATCAACAGCCCCGAGTTTGCGTCTGAGCCCGTCACCATTCGCTCCGGC
GGCACTCTGCTGCACGAGGCGGCGCGCCAAAAAGATACTCGTCTCATCGAGACACTGCTGCTCCACGGCGGAGAC
CCGTTCAGGCGTGACCGCAAGGGTAAGCTCCCCCAGTCCGTCACATCCGACGACGGCGTCAAGTCCATCCTCAAG
AACTCGCCCGCCGCCGTGGCCGCCCAGAGGGGCATCCAGGAAAAGGCCGTCCTGGGCCATGCTGCCTCTCACGTC
GTTTCCCCGACAGGACCCGCCGATCTCATGGCCGGCAAGGAGGCCCGCGAGATCAAGGGCTACCTCAAGAAGTGG
ACCAACTACCGCAAGGGCTACCAACTGCGCTGGTTCGTGCTCGAGGACGGCGTGCTGAGCTACTACAAACACCAG
GACGATGCTGGCTCAGCCTGCCGGGGCGCCATCAACATGAGGATCGCCAAGCTGCACATGAGCGCTGACGAAAAG
ACAAAGTTTGAGATCATCGGCAAGTCGTCGGTCAAGTACACTCTCAAGGCTAACCACGAGGTCGAGGCCAAGCGC
TGGTTCTGGGCTCTCAACAACTCCATCCAGTGGACCAAAGACCAGGCAAAGGAGGAGGAGCGCAGGGCCTCGCGC
ACCGCCGAGTACCTCAAGCATGCCAAGGTCGACACGGGCGGCTCTCTCTCGGCTCACGACTCGCTCAACGAGAAC
ACGAGCATGTCGGAACTGCAAAAGACGTATTCGCACGCGCCGAGCCGATCTCCCTCACACGCACCCAGTCGCTCG
CTCTCACACGCCAGGACGGGCAGCGTAGGCGACGAAGACGAAGATGACGAGCGATTTACTGGTCTCGGGACCGAG
GGCGATGCTGGCTCTAGAGCGCCTGGGCCGACGACACTGGCGGGCGATCATGCCGATGACGACGACGACTACGAC
GAGAAGAGTGTCCGTGTCGAGCCCGGGGCCACCAAAGACGCGCTCAACATCACAGCCCAGTCAGCCAGGCTACAG
CTCGAGACAATGACGGCCGTCCACGCGGCGCTACAGGCGGAGCTCTCACAGAGCCCGGCGACTCCCCTTTCGGAC
GTCAAGGTGACGCAGGCGCTGTCGACGTATGACGCGGCAACGCACAGCCTGACGGGCCTCGTGGGTGACTTGCTG
CGTATCTCCCGGGACAGAGACGCCTACTGGCAGTACCGCCTGGACCGCGAGGCCAACGTCCGGCGCATGTGGGAG
GAGAGCATGCAGAGGGTGGCGCGCGAGCAGGAGGAGCTCGAGGCTCGAATGGGCGAGACCGAGAGCAAGCGACGA
TTGACTAAGAAGGCCCTCAAAGAGGTCATGATCAGCGGAGCCGGCGCCTCGGCCAACGCGACGCCGACGGTCGAG
AAGCCTCAGGCCGAGGCCGAGGTAGACGCCAGGCCGCTCGGACGCCGGGCCACGGCTCTCGATCAGCTGGGCGAG
CTGTCCGAGTCCGAGTCGGAAGCGGGCGACGAGTTCTTTGACGCCGTCGACGCCGGAGAGGTCGAGGTAGAGCCG
CTGCCGGCAGATGAACGCATAGACGAGGCCGATGGAGTCGTTGTCTCGGGCGTCGATATAAGCTCGTCGTTCAAG
GGATACGAGAACGGCATCAGACATAGGCTCAAGATGGATGCCGATGACCGGCCCAAGGTGTCGCTATGGGGCATA
CTGAAATCCATGATTGGCAAGGACATGACCAAGATGACGCTCCCCGTCTCCTTCAACGAGCCTACATCGCTGCTC
TACCGCTGCGGTGAGGACATGGAGTATGCCGATCTGTTGGACCGGGCCGTCGAGAGGGCCGACTCGATCGAGCGT
CTCATCTACGTGGCGGCCTTTGCGGCGAGCGAGTACGCGTCCACCATCGGCCGGGTAGCCAAGCCCTTCAACCCG
CTGCTAGGAGAGACGTTCGAGTACGTGCGGCCGGACAAGAACTACCGCTTCTTCATCGAACAGGTCAGCCATCAT
CCTCCCATCGGCGCCGCCTGGGCCGAGTCTCCCCACTGGACGTACTGGGGCGAGTCGGCGGTGCGGTCCAAGTTC
TATGGCAAGTCTTTCGACATTAACCCGCTCGGCACCTGGTTCCTGCGTCTGCGTCCCAAGGCCGGTGGACGTGAG
GACCTGTACACGTGGAAGAAGGTGACGTCGTCGGTGATTGGCATCATCACCGGAAACCCGACAGTCGACAACTAC
GGGCCCATGGAGATTAAAAACTGGACGACGGGCGAGGTGGCTCACGTCGACTTTAAACCGCGAGGCTGGAAAGCA
TCAAGCGCGTATCAGGTCGTCGGCAGGATCGTCGACGCCGACGGCCAGGTCCGCTTCAGCATGGGTGGGCGTTGG
AACTCGAAGCTTTACGCTCGCCTGACGCCGGGTTACGAGGCCACGGTGGAAGAGCCCAAGGACGGCGGCGGCGAC
TTCGGCTCCGGGGGTTTGACGGACCCGAACCGGGCCTACCTGGTGTGGGAGGCGCACGAGCGGCCGACGGGCATC
CCTTTCAACCTGACACCGTTTGTGCTGACTTTCAACCACATCGACGACAAGCTGCGGCCTTGGCTGCCACCGACA
GACTCGCGGCTTCGACCTGATCAGCGGGCCATGGAGGACGGAGAGTACGATGTTGCGGCCGAGGAGAAGAACCGG
CTGGAGGAGCGGCAGCGAGACAGGAGGCGGGAGCGCGAGGCCCGGGGCGAGGAATTTGTGCCGGCCTGGTTCACG
CGGGACCGATGCGCCGTGACGGGAGAGGAATATTGGAAGTTCAACGGCAAGTATTGGGAGCAGAGGGACAAGGCT
GGGCCTGCAGGGGACGCGGACAAGGCATGGGCTGGGCTGGAGCCTATTTTCTCGTAG
Transcript >Ophcf2|00799
ATGTCGGACGCGGCTGATAGCTCTCACCGGCGCTCCATGTCGGCTGCTGCCCTCTCGCTGCTTCGCCGCAAGGAT
ACGCGAGAGGATGACTCCGGTTCCGAAGACGGCATCAAGTCCCCCCGGAAGCTTTCCTCGCACCAGCATGCCTCG
AGGACGTCAACCAGTATTGCTCGATCGGTGCCGCAGCCGCCGCCGCAACTGAAACCCGTCGCCGACAAGACGGCG
AGTCTGGAACAGTCGATGCGCAAGTTTCGCGTCGTCGAGGCTCTGCGGAGCGGCGACACAGCTTCCATCTCGAGG
GCCATGCGAGACACGGCCGACCCCGACCGCCGTCACAGCACTGCCTCCTTGTCCAACCTCAGCTCCGGCCCCGGC
CCCGGCCCGGGTCCTCTTCGGGATACTACCGTTCTGCATCTAGCTATTCAGTGCGCCGAGCTGCCCGTGGTCGAG
TATGTGCTCTCCAACGGCGTTGGCATCGATGTCAATGCCCGAGACAAGGACGGGAATACGCCCTTGCACGTGGCC
GCCATCAACGGCCGAACGCCCGTCGTCAAGATGCTCCTCGACCACAAAGAAATCAACGATGCCGTCGCAAACGCT
CATACCAAGCTGCCCATCGACGTGGCTCGTAACCCCGAAATCTTTCAGCTCCTGCAACTGTCACGCTCTCTTTTC
GCCGAGGCAAAGGTGACACAGATCCAGGAGCTCGTGGCTCGCAAGGACTACGCCGGCCTCTCGCGCGTGTTGGAG
GAGCCCCGGCTCAAGACGGTGCTCGACATCAACAGCCCCGAGTTTGCGTCTGAGCCCGTCACCATTCGCTCCGGC
GGCACTCTGCTGCACGAGGCGGCGCGCCAAAAAGATACTCGTCTCATCGAGACACTGCTGCTCCACGGCGGAGAC
CCGTTCAGGCGTGACCGCAAGGGTAAGCTCCCCCAGTCCGTCACATCCGACGACGGCGTCAAGTCCATCCTCAAG
AACTCGCCCGCCGCCGTGGCCGCCCAGAGGGGCATCCAGGAAAAGGCCGTCCTGGGCCATGCTGCCTCTCACGTC
GTTTCCCCGACAGGACCCGCCGATCTCATGGCCGGCAAGGAGGCCCGCGAGATCAAGGGCTACCTCAAGAAGTGG
ACCAACTACCGCAAGGGCTACCAACTGCGCTGGTTCGTGCTCGAGGACGGCGTGCTGAGCTACTACAAACACCAG
GACGATGCTGGCTCAGCCTGCCGGGGCGCCATCAACATGAGGATCGCCAAGCTGCACATGAGCGCTGACGAAAAG
ACAAAGTTTGAGATCATCGGCAAGTCGTCGGTCAAGTACACTCTCAAGGCTAACCACGAGGTCGAGGCCAAGCGC
TGGTTCTGGGCTCTCAACAACTCCATCCAGTGGACCAAAGACCAGGCAAAGGAGGAGGAGCGCAGGGCCTCGCGC
ACCGCCGAGTACCTCAAGCATGCCAAGGTCGACACGGGCGGCTCTCTCTCGGCTCACGACTCGCTCAACGAGAAC
ACGAGCATGTCGGAACTGCAAAAGACGTATTCGCACGCGCCGAGCCGATCTCCCTCACACGCACCCAGTCGCTCG
CTCTCACACGCCAGGACGGGCAGCGTAGGCGACGAAGACGAAGATGACGAGCGATTTACTGGTCTCGGGACCGAG
GGCGATGCTGGCTCTAGAGCGCCTGGGCCGACGACACTGGCGGGCGATCATGCCGATGACGACGACGACTACGAC
GAGAAGAGTGTCCGTGTCGAGCCCGGGGCCACCAAAGACGCGCTCAACATCACAGCCCAGTCAGCCAGGCTACAG
CTCGAGACAATGACGGCCGTCCACGCGGCGCTACAGGCGGAGCTCTCACAGAGCCCGGCGACTCCCCTTTCGGAC
GTCAAGGTGACGCAGGCGCTGTCGACGTATGACGCGGCAACGCACAGCCTGACGGGCCTCGTGGGTGACTTGCTG
CGTATCTCCCGGGACAGAGACGCCTACTGGCAGTACCGCCTGGACCGCGAGGCCAACGTCCGGCGCATGTGGGAG
GAGAGCATGCAGAGGGTGGCGCGCGAGCAGGAGGAGCTCGAGGCTCGAATGGGCGAGACCGAGAGCAAGCGACGA
TTGACTAAGAAGGCCCTCAAAGAGGTCATGATCAGCGGAGCCGGCGCCTCGGCCAACGCGACGCCGACGGTCGAG
AAGCCTCAGGCCGAGGCCGAGGTAGACGCCAGGCCGCTCGGACGCCGGGCCACGGCTCTCGATCAGCTGGGCGAG
CTGTCCGAGTCCGAGTCGGAAGCGGGCGACGAGTTCTTTGACGCCGTCGACGCCGGAGAGGTCGAGGTAGAGCCG
CTGCCGGCAGATGAACGCATAGACGAGGCCGATGGAGTCGTTGTCTCGGGCGTCGATATAAGCTCGTCGTTCAAG
GGATACGAGAACGGCATCAGACATAGGCTCAAGATGGATGCCGATGACCGGCCCAAGGTGTCGCTATGGGGCATA
CTGAAATCCATGATTGGCAAGGACATGACCAAGATGACGCTCCCCGTCTCCTTCAACGAGCCTACATCGCTGCTC
TACCGCTGCGGTGAGGACATGGAGTATGCCGATCTGTTGGACCGGGCCGTCGAGAGGGCCGACTCGATCGAGCGT
CTCATCTACGTGGCGGCCTTTGCGGCGAGCGAGTACGCGTCCACCATCGGCCGGGTAGCCAAGCCCTTCAACCCG
CTGCTAGGAGAGACGTTCGAGTACGTGCGGCCGGACAAGAACTACCGCTTCTTCATCGAACAGGTCAGCCATCAT
CCTCCCATCGGCGCCGCCTGGGCCGAGTCTCCCCACTGGACGTACTGGGGCGAGTCGGCGGTGCGGTCCAAGTTC
TATGGCAAGTCTTTCGACATTAACCCGCTCGGCACCTGGTTCCTGCGTCTGCGTCCCAAGGCCGGTGGACGTGAG
GACCTGTACACGTGGAAGAAGGTGACGTCGTCGGTGATTGGCATCATCACCGGAAACCCGACAGTCGACAACTAC
GGGCCCATGGAGATTAAAAACTGGACGACGGGCGAGGTGGCTCACGTCGACTTTAAACCGCGAGGCTGGAAAGCA
TCAAGCGCGTATCAGGTCGTCGGCAGGATCGTCGACGCCGACGGCCAGGTCCGCTTCAGCATGGGTGGGCGTTGG
AACTCGAAGCTTTACGCTCGCCTGACGCCGGGTTACGAGGCCACGGTGGAAGAGCCCAAGGACGGCGGCGGCGAC
TTCGGCTCCGGGGGTTTGACGGACCCGAACCGGGCCTACCTGGTGTGGGAGGCGCACGAGCGGCCGACGGGCATC
CCTTTCAACCTGACACCGTTTGTGCTGACTTTCAACCACATCGACGACAAGCTGCGGCCTTGGCTGCCACCGACA
GACTCGCGGCTTCGACCTGATCAGCGGGCCATGGAGGACGGAGAGTACGATGTTGCGGCCGAGGAGAAGAACCGG
CTGGAGGAGCGGCAGCGAGACAGGAGGCGGGAGCGCGAGGCCCGGGGCGAGGAATTTGTGCCGGCCTGGTTCACG
CGGGACCGATGCGCCGTGACGGGAGAGGAATATTGGAAGTTCAACGGCAAGTATTGGGAGCAGAGGGACAAGGCT
GGGCCTGCAGGGGACGCGGACAAGGCATGGGCTGGGCTGGAGCCTATTTTCTCGTAG
Gene >Ophcf2|00799
ATGTCGGACGCGGCTGATAGGCACGTCGAGACCAACCTCCAGGCTCGAAGCCAGCGCTGACACAGCCGCATACAA
GCTCTCACCGGCGCTCCATGTCGGCTGCTGCCCTCTCGCTGCTTCGCCGCAAGGATACGCGAGAGGATGACTCCG
GTTCCGAAGACGGCATCAAGTCCCCCCGGAAGCTTTCCTCGCACCAGCATGCCTCGAGGACGTCAACCAGTATTG
CTCGATCGGTGCCGCAGCCGCCGCCGCAACTGAAACCCGTCGCCGACAAGACGGCGAGTCTGGAACAGTCGATGC
GCAAGTTTCGCGTCGTCGAGGCTCTGCGGAGCGGCGACACAGCTTCCATCTCGAGGGCCATGCGAGACACGGCCG
ACCCCGACCGCCGTCACAGCACTGCCTCCTTGTCCAACCTCAGCTCCGGCCCCGGCCCCGGCCCGGGTCCTCTTC
GGGATACTACCGTTCTGCATCTAGCTATTCAGTGCGCCGAGCTGCCCGTGGTCGAGTATGTGCTCTCCAACGGCG
TTGGCATCGATGTCAATGCCCGAGACAAGGACGGGAATACGCCCTTGCACGTGGCCGCCATCAACGGCCGAACGC
CCGTCGTCAAGATGCTCCTCGACCACAAAGAAATCAACGATGCCGTCGCAAACGCTCATACCAAGCTGCCCATCG
ACGTGGCTCGTAACCCCGAAATCTTTCAGCTCCTGCAACTGTCACGCTCTCTTTTCGCCGAGGCAAAGGTGACAC
AGATCCAGGAGCTCGTGGCTCGCAAGGACTACGCCGGCCTCTCGCGCGTGTTGGAGGAGCCCCGGCTCAAGACGG
TGCTCGACATCAACAGCCCCGAGTTTGCGTCTGAGCCCGTCACCATTCGCTCCGGCGGCACTCTGCTGCACGAGG
CGGCGCGCCAAAAAGATACTCGTCTCATCGAGACACTGCTGCTCCACGGCGGAGACCCGTTCAGGCGTGACCGCA
AGGGTAAGCTCCCCCAGTCCGTCACATCCGACGACGGCGTCAAGTCCATCCTCAAGAACTCGCCCGCCGCCGTGG
CCGCCCAGAGGGGCATCCAGGAAAAGGCCGTCCTGGGCCATGCTGCCTCTCACGTCGTTTCCCCGACAGGACCCG
CCGATCTCATGGCCGGCAAGGAGGCCCGCGAGATCAAGGGCTACCTCAAGAAGTGGACCAACTACCGCAAGGGCT
ACCAACTGCGCTGGTTCGTGCTCGAGGACGGCGTGCTGAGCTACTACAAACACCAGGACGATGCTGGCTCAGCCT
GCCGGGGCGCCATCAACATGAGGATCGCCAAGCTGCACATGAGCGCTGACGAAAAGACAAAGTTTGAGATCATCG
GCAAGTCGTCGGTCAAGTACACTCTCAAGGCTAACCACGAGGTCGAGGCCAAGCGCTGGTTCTGGGCTCTCAACA
ACTCCATCCAGTGGACCAAAGACCAGGCAAAGGAGGAGGAGCGCAGGGCCTCGCGCACCGCCGAGTACCTCAAGC
ATGCCAAGGTCGACACGGGCGGCTCTCTCTCGGCTCACGACTCGCTCAACGAGAACACGAGCATGTCGGAACTGC
AAAAGACGTATTCGCACGCGCCGAGCCGATCTCCCTCACACGCACCCAGTCGCTCGCTCTCACACGCCAGGACGG
GCAGCGTAGGCGACGAAGACGAAGATGACGAGCGATTTACTGGTCTCGGGACCGAGGGCGATGCTGGCTCTAGAG
CGCCTGGGCCGACGACACTGGCGGGCGATCATGCCGATGACGACGACGACTACGACGAGAAGAGTGTCCGTGTCG
AGCCCGGGGCCACCAAAGACGCGCTCAACATCACAGCCCAGTCAGCCAGGCTACAGCTCGAGACAATGACGGCCG
TCCACGCGGCGCTACAGGCGGAGCTCTCACAGAGCCCGGCGACTCCCCTTTCGGACGTCAAGGTGACGCAGGCGC
TGTCGACGTATGACGCGGCAACGCACAGCCTGACGGGCCTCGTGGGTGACTTGCTGCGTATCTCCCGGGACAGAG
ACGCCTACTGGCAGTACCGCCTGGACCGCGAGGCCAACGTCCGGCGCATGTGGGAGGAGAGCATGCAGAGGGTGG
CGCGCGAGCAGGAGGAGCTCGAGGCTCGAATGGGCGAGACCGAGAGCAAGCGACGATTGACTAAGAAGGCCCTCA
AAGAGGTCATGATCAGCGGAGCCGGCGCCTCGGCCAACGCGACGCCGACGGTCGAGAAGCCTCAGGCCGAGGCCG
AGGTAGACGCCAGGCCGCTCGGACGCCGGGCCACGGCTCTCGATCAGCTGGGCGAGCTGTCCGAGTCCGAGTCGG
AAGCGGGCGACGAGTTCTTTGACGCCGTCGACGCCGGAGAGGTCGAGGTAGAGCCGCTGCCGGCAGATGAACGCA
TAGACGAGGCCGATGGAGTCGTTGTCTCGGGCGTCGATATAAGCTCGTCGTTCAAGGGATACGAGAACGGCATCA
GACATAGGCTCAAGATGGATGCCGATGACCGGCCCAAGGTGTCGCTATGGGTAGGCTGTTCTTTTTCTCTGGTAA
TGAATGAGAAGACGCAATGGACCAACTGACACCACCTGGAACAGGGCATACTGAAATCCATGATTGGCAAGGACA
TGACCAAGATGACGCTCCCCGTCTCCTTCAACGAGCCTACATCGCTGCTCTACCGCTGCGGTGAGGACATGGAGT
ATGCCGATCTGTTGGACCGGGCCGTCGAGAGGGCCGACTCGATCGAGCGTCTCATCTACGTGGCGGCCTTTGCGG
CGAGCGAGTACGCGTCCACCATCGGCCGGGTAGCCAAGCCCTTCAACCCGCTGCTAGGAGAGACGTTCGAGTACG
TGCGGCCGGACAAGAACTACCGCTTCTTCATCGAACAGGTCAGCCATCATCCTCCCATCGGCGCCGCCTGGGCCG
AGTCTCCCCACTGGACGTACTGGGGCGAGTCGGCGGTGCGGTCCAAGTTCTATGGCAAGTCTTTCGACATTAACC
CGCTCGGCACCTGGTTCCTGCGTCTGCGTCCCAAGGCCGGTGGACGTGAGGACCTGTACACGTGGAAGAAGGTGA
CGTCGTCGGTGATTGGCATCATCACCGGAAACCCGACAGTCGACAACTACGGGCCCATGGAGATTAAAAACTGGA
CGACGGGCGAGGTGGCTCACGTCGACTTTAAACCGCGAGGCTGGAAAGCATCAAGCGCGTATCAGGTCGTCGGCA
GGATCGTCGACGCCGACGGCCAGGTCCGCTTCAGCATGGGTGGGCGTTGGAACTCGAAGCTTTACGCTCGCCTGA
CGCCGGGTTACGAGGCCACGGTGGAAGAGCCCAAGGACGGCGGCGGCGACTTCGGCTCCGGGGGTTTGACGGACC
CGAACCGGGCCTACCTGGTGTGGGAGGCGCACGAGCGGCCGACGGGCATCCCTTTCAACCTGACACCGTTTGTGC
TGACTTTCAACCACATCGACGACAAGCTGCGGCCTTGGCTGCCACCGACAGACTCGCGGCTTCGACCTGATCAGC
GGGCCATGGAGGACGGAGAGTACGATGTTGCGGCCGAGGAGAAGAACCGGCTGGAGGAGCGGCAGCGAGACAGGA
GGCGGGAGCGCGAGGCCCGGGGCGAGGAATTTGTGCCGGCCTGGTTCACGCGGGACCGATGCGCCGTGACGGGAG
AGGAATATTGGAAGTTCAACGGCAAGTATTGGGAGCAGAGGGACAAGGCTGGGCCTGCAGGGGACGCGGACAAGG
CATGGGCTGGGCTGGAGCCTATTTTCTCGTAG

© 2023 - Robin Ohm - Utrecht University - The Netherlands

Built with Python Django and Wagtail