Fungal Genomics

at Utrecht University

General Properties

Protein IDOphcf2|00795
Gene name
Locationscaffold_01:3134725..3137140
Strand-
Gene length (bp)2415
Transcript length (bp)2415
Coding sequence length (bp)2415
Protein length (aa) 805

Your browser does not support drawing a protein figure.

PFAM Domains

PFAM Domain ID Short name Long name E-value Start End
PF01794 Ferric_reduct Ferric reductase like transmembrane component 2.8E-17 223 346
PF08030 NAD_binding_6 Ferric reductase NAD binding domain 2.0E-13 503 779
PF08022 FAD_binding_8 FAD-binding domain 1.0E-11 395 494

GO

GO Term Description Terminal node
GO:0016491 oxidoreductase activity Yes
GO:0003824 catalytic activity No
GO:0003674 molecular_function No

SignalP

[Help with interpreting these statistics]
SignalP signal predicted Location
(based on Ymax)
D score
(significance: > 0.45)
No 1 - 24 0.5

Transmembrane Domains

Domain # Start End Length
1 36 58 22
2 182 204 22
3 219 236 17
4 257 279 22
5 299 321 22
6 328 350 22
7 355 377 22
8 500 522 22

Transcription Factor Class

(None)

Expression data

Analysis 1: Expression analysis during behavioral modification. Published in: Will et al., G3, 2020

Click here for more information

Sequences

Type of sequenceSequence
Locus Download genbank file of locus
The gene with 5 kb flanks (if sufficient flanking sequence is available). For use in cloning design programs. NOTE: features (genes or exons) that are only partially contained within the sequence are completely excluded.
Protein >Ophcf2|00795
MAGLARRINIPLTPTSPPGLVQADAVDPWSRAGRYGLGWTYLALAVVGVVVVVRVWHLWQDKIRQAIYKEAVEER
YRGLYGGVQEEEEQEEQEEQEEQEDHQNLQREREHQEQQQQQQQEHHHHHHHHQHNQHFSLFPTASFRPRAHFSS
VTWVNDTLALFRWVFYRPIPDVVWRKHRFTSSSLAVLACAALAVIMVTLYCFLQQPLYWQSIRFGSPPVAIRAGM
MAVAMTPWIVATSMKANLLTLIVGIGPDRLNVIHRWLGYLCLLLVLVHMVPFYLQPVWRDGGMSVFDQLFPDGSG
FIYGTGVACFVPLVWLCVGSLPWLRRKAFEAFAMLHAPAGAVYVGLLFWHTKNYLLSWSYLYATVAIWAACYLAR
FVFKLNWSRPGRLSFLVGDEASITLLADNAIKLTIPTQMRWRPGQYVYLRMPAVSLMGNHPFTIASLCSDDFPSD
YGDSYRDCVLVFKPYHGFTQRLLQTAIANGPLHSYRAFLDGPYGGMRRELAAFDTCILIAGGSGITSLMSQLLNL
VKRMRDGKAITRKVMVVWALKRFEAMDWFREELRICQESAPPESVVCKFFLTSAVRHRPFDDGPTMTMTMARDNE
HNPRALNHMLHDKLDGFVAGIASKRNSALIVAEAQGDVERERELRAEDEDRITALPQQCYLQPHQPEPLPVRAPE
LAHLRQHGDLDKRRPVSTFGPPAGFDFGFPATPTEFQKSLMRFAFPIPHQMDGGWTIEYGRPQLGHMLRQWATGG
SDGRGILGRRTAVFVCGPPSMREGVANTVARLQAAIWGDDELEELFLHTENFAL*
Coding >Ophcf2|00795
ATGGCCGGCCTCGCGCGACGCATCAACATCCCGCTGACGCCGACCAGTCCTCCGGGGCTGGTGCAGGCCGATGCC
GTCGATCCGTGGTCTCGGGCCGGGCGGTACGGCTTGGGCTGGACGTACCTGGCGCTGGCCGTCGTGGGCGTCGTC
GTCGTCGTGCGCGTCTGGCACCTGTGGCAGGACAAGATACGGCAGGCCATATACAAGGAGGCGGTGGAGGAGCGC
TATCGAGGGCTGTACGGGGGTGTACAGGAGGAGGAGGAGCAGGAGGAGCAGGAGGAGCAGGAGGAGCAGGAGGAC
CATCAGAATCTGCAGCGGGAGCGGGAGCATCAAGAGCAGCAGCAGCAGCAGCAGCAGGAGCATCATCATCATCAT
CATCATCACCAGCATAACCAGCACTTCTCCCTCTTTCCCACCGCCAGCTTCCGTCCCCGCGCCCACTTCTCGTCC
GTCACTTGGGTCAACGACACGCTCGCCCTCTTCAGATGGGTCTTCTACCGCCCCATCCCGGACGTGGTCTGGCGC
AAGCACCGCTTCACCTCGTCGTCGCTGGCGGTGCTGGCCTGCGCCGCCTTGGCCGTCATCATGGTGACGCTCTAC
TGCTTCCTGCAACAGCCTCTTTATTGGCAGAGCATCCGCTTCGGGTCGCCGCCCGTCGCCATCCGAGCCGGCATG
ATGGCCGTCGCCATGACGCCGTGGATCGTGGCCACCAGCATGAAGGCCAACCTGCTGACGCTCATAGTCGGAATC
GGCCCAGACCGCCTCAACGTCATCCACCGCTGGCTGGGTTATCTGTGCCTGCTGCTGGTGCTCGTCCACATGGTC
CCCTTTTACCTTCAGCCTGTATGGCGTGACGGCGGCATGTCCGTCTTCGACCAGCTGTTCCCGGACGGCAGCGGC
TTCATCTACGGCACCGGCGTCGCCTGCTTCGTGCCGCTCGTCTGGCTATGCGTCGGCTCGCTTCCCTGGCTTCGA
AGGAAGGCCTTCGAGGCCTTTGCCATGCTGCACGCCCCGGCGGGAGCCGTCTACGTCGGGCTGCTATTCTGGCAC
ACCAAGAATTACCTGCTGTCGTGGTCGTATCTGTACGCGACCGTGGCCATCTGGGCCGCCTGTTACCTCGCTCGC
TTCGTCTTCAAGCTCAACTGGAGCCGGCCTGGGCGTCTTTCGTTCCTGGTGGGAGACGAGGCCTCCATCACGCTG
CTGGCAGACAACGCCATCAAGCTGACCATCCCGACACAAATGCGCTGGCGGCCTGGCCAGTACGTCTACCTGCGC
ATGCCAGCCGTCTCCTTGATGGGAAATCATCCCTTCACCATCGCCTCTCTGTGCAGCGACGACTTTCCTTCCGAC
TACGGCGACAGCTACCGCGACTGTGTCCTCGTCTTCAAGCCCTATCATGGCTTCACCCAACGCCTGCTGCAGACG
GCCATCGCCAACGGGCCGCTGCACTCCTACCGCGCCTTTCTCGACGGGCCCTATGGTGGAATGAGGCGAGAGCTG
GCTGCCTTTGACACGTGCATCCTCATCGCCGGCGGCAGCGGCATCACCTCTCTCATGTCACAGCTGCTCAACCTG
GTCAAGCGCATGCGAGATGGCAAGGCAATAACCCGCAAGGTCATGGTCGTCTGGGCGCTGAAGCGGTTCGAGGCC
ATGGACTGGTTCCGCGAAGAGCTGCGCATCTGCCAGGAGTCTGCTCCTCCGGAGAGCGTCGTTTGCAAGTTCTTC
CTAACGTCTGCTGTGCGCCATCGTCCGTTTGACGACGGCCCGACCATGACCATGACCATGGCACGGGACAACGAG
CATAATCCGAGGGCGCTCAACCACATGCTGCACGATAAGCTCGATGGCTTCGTCGCCGGCATCGCCTCTAAGCGC
AACTCGGCCTTGATCGTGGCCGAGGCTCAAGGAGACGTCGAGCGAGAGCGCGAGTTGCGGGCCGAAGACGAGGAT
CGCATCACGGCGCTGCCGCAACAGTGTTACCTGCAGCCTCATCAGCCGGAGCCGCTCCCGGTGCGGGCCCCCGAG
CTGGCCCACCTCCGGCAACACGGGGATCTCGACAAGCGACGGCCCGTCTCCACTTTCGGCCCGCCAGCCGGCTTC
GACTTTGGCTTCCCCGCGACGCCGACCGAGTTCCAGAAGAGCCTTATGCGGTTCGCGTTTCCTATCCCTCATCAG
ATGGACGGCGGCTGGACCATCGAGTACGGCCGTCCGCAGCTGGGCCATATGCTTCGTCAGTGGGCAACGGGCGGC
TCCGACGGCCGGGGTATCCTGGGCCGGAGGACGGCGGTCTTTGTGTGCGGCCCGCCTTCGATGCGCGAGGGCGTC
GCCAATACGGTGGCCAGGTTGCAGGCTGCCATCTGGGGGGATGACGAGCTGGAGGAGCTGTTTCTGCACACCGAG
AACTTTGCCCTGTGA
Transcript >Ophcf2|00795
ATGGCCGGCCTCGCGCGACGCATCAACATCCCGCTGACGCCGACCAGTCCTCCGGGGCTGGTGCAGGCCGATGCC
GTCGATCCGTGGTCTCGGGCCGGGCGGTACGGCTTGGGCTGGACGTACCTGGCGCTGGCCGTCGTGGGCGTCGTC
GTCGTCGTGCGCGTCTGGCACCTGTGGCAGGACAAGATACGGCAGGCCATATACAAGGAGGCGGTGGAGGAGCGC
TATCGAGGGCTGTACGGGGGTGTACAGGAGGAGGAGGAGCAGGAGGAGCAGGAGGAGCAGGAGGAGCAGGAGGAC
CATCAGAATCTGCAGCGGGAGCGGGAGCATCAAGAGCAGCAGCAGCAGCAGCAGCAGGAGCATCATCATCATCAT
CATCATCACCAGCATAACCAGCACTTCTCCCTCTTTCCCACCGCCAGCTTCCGTCCCCGCGCCCACTTCTCGTCC
GTCACTTGGGTCAACGACACGCTCGCCCTCTTCAGATGGGTCTTCTACCGCCCCATCCCGGACGTGGTCTGGCGC
AAGCACCGCTTCACCTCGTCGTCGCTGGCGGTGCTGGCCTGCGCCGCCTTGGCCGTCATCATGGTGACGCTCTAC
TGCTTCCTGCAACAGCCTCTTTATTGGCAGAGCATCCGCTTCGGGTCGCCGCCCGTCGCCATCCGAGCCGGCATG
ATGGCCGTCGCCATGACGCCGTGGATCGTGGCCACCAGCATGAAGGCCAACCTGCTGACGCTCATAGTCGGAATC
GGCCCAGACCGCCTCAACGTCATCCACCGCTGGCTGGGTTATCTGTGCCTGCTGCTGGTGCTCGTCCACATGGTC
CCCTTTTACCTTCAGCCTGTATGGCGTGACGGCGGCATGTCCGTCTTCGACCAGCTGTTCCCGGACGGCAGCGGC
TTCATCTACGGCACCGGCGTCGCCTGCTTCGTGCCGCTCGTCTGGCTATGCGTCGGCTCGCTTCCCTGGCTTCGA
AGGAAGGCCTTCGAGGCCTTTGCCATGCTGCACGCCCCGGCGGGAGCCGTCTACGTCGGGCTGCTATTCTGGCAC
ACCAAGAATTACCTGCTGTCGTGGTCGTATCTGTACGCGACCGTGGCCATCTGGGCCGCCTGTTACCTCGCTCGC
TTCGTCTTCAAGCTCAACTGGAGCCGGCCTGGGCGTCTTTCGTTCCTGGTGGGAGACGAGGCCTCCATCACGCTG
CTGGCAGACAACGCCATCAAGCTGACCATCCCGACACAAATGCGCTGGCGGCCTGGCCAGTACGTCTACCTGCGC
ATGCCAGCCGTCTCCTTGATGGGAAATCATCCCTTCACCATCGCCTCTCTGTGCAGCGACGACTTTCCTTCCGAC
TACGGCGACAGCTACCGCGACTGTGTCCTCGTCTTCAAGCCCTATCATGGCTTCACCCAACGCCTGCTGCAGACG
GCCATCGCCAACGGGCCGCTGCACTCCTACCGCGCCTTTCTCGACGGGCCCTATGGTGGAATGAGGCGAGAGCTG
GCTGCCTTTGACACGTGCATCCTCATCGCCGGCGGCAGCGGCATCACCTCTCTCATGTCACAGCTGCTCAACCTG
GTCAAGCGCATGCGAGATGGCAAGGCAATAACCCGCAAGGTCATGGTCGTCTGGGCGCTGAAGCGGTTCGAGGCC
ATGGACTGGTTCCGCGAAGAGCTGCGCATCTGCCAGGAGTCTGCTCCTCCGGAGAGCGTCGTTTGCAAGTTCTTC
CTAACGTCTGCTGTGCGCCATCGTCCGTTTGACGACGGCCCGACCATGACCATGACCATGGCACGGGACAACGAG
CATAATCCGAGGGCGCTCAACCACATGCTGCACGATAAGCTCGATGGCTTCGTCGCCGGCATCGCCTCTAAGCGC
AACTCGGCCTTGATCGTGGCCGAGGCTCAAGGAGACGTCGAGCGAGAGCGCGAGTTGCGGGCCGAAGACGAGGAT
CGCATCACGGCGCTGCCGCAACAGTGTTACCTGCAGCCTCATCAGCCGGAGCCGCTCCCGGTGCGGGCCCCCGAG
CTGGCCCACCTCCGGCAACACGGGGATCTCGACAAGCGACGGCCCGTCTCCACTTTCGGCCCGCCAGCCGGCTTC
GACTTTGGCTTCCCCGCGACGCCGACCGAGTTCCAGAAGAGCCTTATGCGGTTCGCGTTTCCTATCCCTCATCAG
ATGGACGGCGGCTGGACCATCGAGTACGGCCGTCCGCAGCTGGGCCATATGCTTCGTCAGTGGGCAACGGGCGGC
TCCGACGGCCGGGGTATCCTGGGCCGGAGGACGGCGGTCTTTGTGTGCGGCCCGCCTTCGATGCGCGAGGGCGTC
GCCAATACGGTGGCCAGGTTGCAGGCTGCCATCTGGGGGGATGACGAGCTGGAGGAGCTGTTTCTGCACACCGAG
AACTTTGCCCTGTGA
Gene >Ophcf2|00795
ATGGCCGGCCTCGCGCGACGCATCAACATCCCGCTGACGCCGACCAGTCCTCCGGGGCTGGTGCAGGCCGATGCC
GTCGATCCGTGGTCTCGGGCCGGGCGGTACGGCTTGGGCTGGACGTACCTGGCGCTGGCCGTCGTGGGCGTCGTC
GTCGTCGTGCGCGTCTGGCACCTGTGGCAGGACAAGATACGGCAGGCCATATACAAGGAGGCGGTGGAGGAGCGC
TATCGAGGGCTGTACGGGGGTGTACAGGAGGAGGAGGAGCAGGAGGAGCAGGAGGAGCAGGAGGAGCAGGAGGAC
CATCAGAATCTGCAGCGGGAGCGGGAGCATCAAGAGCAGCAGCAGCAGCAGCAGCAGGAGCATCATCATCATCAT
CATCATCACCAGCATAACCAGCACTTCTCCCTCTTTCCCACCGCCAGCTTCCGTCCCCGCGCCCACTTCTCGTCC
GTCACTTGGGTCAACGACACGCTCGCCCTCTTCAGATGGGTCTTCTACCGCCCCATCCCGGACGTGGTCTGGCGC
AAGCACCGCTTCACCTCGTCGTCGCTGGCGGTGCTGGCCTGCGCCGCCTTGGCCGTCATCATGGTGACGCTCTAC
TGCTTCCTGCAACAGCCTCTTTATTGGCAGAGCATCCGCTTCGGGTCGCCGCCCGTCGCCATCCGAGCCGGCATG
ATGGCCGTCGCCATGACGCCGTGGATCGTGGCCACCAGCATGAAGGCCAACCTGCTGACGCTCATAGTCGGAATC
GGCCCAGACCGCCTCAACGTCATCCACCGCTGGCTGGGTTATCTGTGCCTGCTGCTGGTGCTCGTCCACATGGTC
CCCTTTTACCTTCAGCCTGTATGGCGTGACGGCGGCATGTCCGTCTTCGACCAGCTGTTCCCGGACGGCAGCGGC
TTCATCTACGGCACCGGCGTCGCCTGCTTCGTGCCGCTCGTCTGGCTATGCGTCGGCTCGCTTCCCTGGCTTCGA
AGGAAGGCCTTCGAGGCCTTTGCCATGCTGCACGCCCCGGCGGGAGCCGTCTACGTCGGGCTGCTATTCTGGCAC
ACCAAGAATTACCTGCTGTCGTGGTCGTATCTGTACGCGACCGTGGCCATCTGGGCCGCCTGTTACCTCGCTCGC
TTCGTCTTCAAGCTCAACTGGAGCCGGCCTGGGCGTCTTTCGTTCCTGGTGGGAGACGAGGCCTCCATCACGCTG
CTGGCAGACAACGCCATCAAGCTGACCATCCCGACACAAATGCGCTGGCGGCCTGGCCAGTACGTCTACCTGCGC
ATGCCAGCCGTCTCCTTGATGGGAAATCATCCCTTCACCATCGCCTCTCTGTGCAGCGACGACTTTCCTTCCGAC
TACGGCGACAGCTACCGCGACTGTGTCCTCGTCTTCAAGCCCTATCATGGCTTCACCCAACGCCTGCTGCAGACG
GCCATCGCCAACGGGCCGCTGCACTCCTACCGCGCCTTTCTCGACGGGCCCTATGGTGGAATGAGGCGAGAGCTG
GCTGCCTTTGACACGTGCATCCTCATCGCCGGCGGCAGCGGCATCACCTCTCTCATGTCACAGCTGCTCAACCTG
GTCAAGCGCATGCGAGATGGCAAGGCAATAACCCGCAAGGTCATGGTCGTCTGGGCGCTGAAGCGGTTCGAGGCC
ATGGACTGGTTCCGCGAAGAGCTGCGCATCTGCCAGGAGTCTGCTCCTCCGGAGAGCGTCGTTTGCAAGTTCTTC
CTAACGTCTGCTGTGCGCCATCGTCCGTTTGACGACGGCCCGACCATGACCATGACCATGGCACGGGACAACGAG
CATAATCCGAGGGCGCTCAACCACATGCTGCACGATAAGCTCGATGGCTTCGTCGCCGGCATCGCCTCTAAGCGC
AACTCGGCCTTGATCGTGGCCGAGGCTCAAGGAGACGTCGAGCGAGAGCGCGAGTTGCGGGCCGAAGACGAGGAT
CGCATCACGGCGCTGCCGCAACAGTGTTACCTGCAGCCTCATCAGCCGGAGCCGCTCCCGGTGCGGGCCCCCGAG
CTGGCCCACCTCCGGCAACACGGGGATCTCGACAAGCGACGGCCCGTCTCCACTTTCGGCCCGCCAGCCGGCTTC
GACTTTGGCTTCCCCGCGACGCCGACCGAGTTCCAGAAGAGCCTTATGCGGTTCGCGTTTCCTATCCCTCATCAG
ATGGACGGCGGCTGGACCATCGAGTACGGCCGTCCGCAGCTGGGCCATATGCTTCGTCAGTGGGCAACGGGCGGC
TCCGACGGCCGGGGTATCCTGGGCCGGAGGACGGCGGTCTTTGTGTGCGGCCCGCCTTCGATGCGCGAGGGCGTC
GCCAATACGGTGGCCAGGTTGCAGGCTGCCATCTGGGGGGATGACGAGCTGGAGGAGCTGTTTCTGCACACCGAG
AACTTTGCCCTGTGA

© 2022 - Robin Ohm - Utrecht University - The Netherlands

Built with Python Django and Wagtail