Fungal Genomics

at Utrecht University

General Properties

Protein IDOphcf2|00788
Gene name
Locationscaffold_01:2980043..2981863
Strand+
Gene length (bp)1820
Transcript length (bp)1467
Coding sequence length (bp)1467
Protein length (aa) 489

Overview

Your browser does not support drawing a protein figure.

PFAM Domains

PFAM Domain ID Short name Long name E-value Start End
PF03781 FGE-sulfatase Sulfatase-modifying factor enzyme 1 1.6E-08 217 401
PF12867 DinB_2 DinB superfamily 1.0E-07 32 164

GO

(None)

Deeploc

[Help with interpreting the results of Deeploc 2.0]
Localizations Signals Cytoplasm Nucleus Extracellular Cell membrane Mitochondrion Plastid Endoplasmic reticulum Lysosome vacuole Golgi apparatus Peroxisome
Cytoplasm 0.5338 0.4875 0.1266 0.0526 0.1688 0.0961 0.1948 0.1395 0.1476 0.1488

SignalP

(None)

Transmembrane Domains

(None)

Transcription Factor Class

(None)

CAZymes

(None)

Secondary Metabolism

(None)

Expression data

Analysis 1: Expression analysis during behavioral modification. Published in: Will et al., G3, 2020

Expression values

Label Description Expression (RPKM) Confidence interval (low) Confidence interval (high)
Fungus Fungus in pure culture 1.90 0.34 3.46
Alive In ants, during behavior modification 1.55 0.18 2.93
Dead In ants, recently dead 10.78 3.83 17.74

Differential expression

Label1 Label2 Q-value Significant difference
Alive Fungus 0.631896 no
Alive Dead 0.000238 yes
Dead Fungus 0.000238 yes

Orthologs

Orthofinder run ID4
Orthogroup431
Change Orthofinder run
Species Protein ID
Ophiocordyceps australis 1348a (Ghana) OphauG2|3502
Ophiocordyceps australis map64 (Brazil) OphauB2|2562
Ophiocordyceps camponoti-floridani Ophcf2|00788 (this protein)
Ophiocordyceps camponoti-floridani Ophcf2|06366
Ophiocordyceps camponoti-rufipedis Ophun1|2144
Ophiocordyceps camponoti-rufipedis Ophun1|5263
Ophiocordyceps kimflemingae Ophio5|2512
Ophiocordyceps kimflemingae Ophio5|3579
Ophiocordyceps subramaniannii Hirsu2|4892

Sequences

Type of sequenceSequence
Locus Download genbank file of locus Download genbank file of locus (reverse complement)
The gene with 5 kb flanks (if sufficient flanking sequence is available). For use in cloning design programs. NOTE: features (genes or exons) that are only partially contained within the sequence are completely excluded.
Protein >Ophcf2|00788
MSDKPNDYAFPLQVLEYAAEPVPCIEEWRTLWKAWDLVTNMIPAEALMEQPIPLRNPLKFYVGHIPTFEDIHLAR
ATGKPLTDPASYAQYFERGIDPDVDDPSQCHDHSELPTVWPDLGEMLDYREKVKARIRSMYETGLAYRDRCVGRA
LWIGYEHEALHLETFLYMAILSPNIQPPPGIPRPDFERMAREAASARVENEWFRIPDQELTLGYEDGESDDGPNR
FFAWDNEREPYDVLVPSFEAQARPICVGEFAAFLVAVGRRDSIPATWVRTGSGGQGDDLQAFVSQHGIRTVWGLI
PLSYAVDWPAMASYNEMSSYCDWLGGGVRIPTLEEVRSIHELVDRRKPSYKPSNNSKKNKTTHTDPETIFTDLTG
ANVGLQNFHPVSVTDRGASLCGLGDLGADFMDGKHVAITGGSWALPPRIAGRKTFQNWWQKGYAYPWVTARLVRD
SPSPSRWPGAGFATQRTGKPAHGQFVRLRNSSAGTSLA*
Coding >Ophcf2|00788
ATGTCCGACAAACCAAACGATTACGCATTCCCCCTTCAGGTCCTGGAGTATGCCGCGGAGCCCGTGCCTTGCATT
GAGGAGTGGAGGACGCTTTGGAAGGCCTGGGACCTCGTCACCAACATGATACCGGCCGAGGCTCTGATGGAGCAG
CCAATCCCGCTTCGGAACCCGCTCAAGTTCTACGTCGGACACATACCGACGTTCGAGGACATACACCTGGCCAGA
GCCACCGGCAAGCCGCTGACGGACCCGGCCTCGTATGCTCAGTACTTTGAACGGGGAATCGATCCCGATGTGGAC
GATCCGTCGCAGTGTCATGATCATAGCGAGCTGCCGACTGTGTGGCCGGATCTGGGCGAGATGCTCGACTACAGG
GAGAAGGTCAAGGCCCGGATACGCTCCATGTATGAGACCGGCTTGGCGTATAGGGATAGATGCGTTGGGAGAGCT
TTATGGATAGGATACGAGCACGAGGCTCTACATCTCGAAACCTTTCTCTACATGGCAATTCTCAGCCCCAACATA
CAACCTCCGCCCGGAATCCCACGGCCAGACTTTGAAAGGATGGCACGAGAGGCAGCCTCAGCACGAGTAGAGAAC
GAATGGTTTCGAATCCCCGACCAGGAACTCACCCTGGGCTACGAAGACGGCGAAAGCGACGACGGGCCGAACCGC
TTCTTCGCCTGGGACAACGAGCGGGAGCCATACGATGTCTTGGTGCCGAGTTTCGAAGCTCAAGCACGGCCTATC
TGCGTTGGCGAGTTTGCTGCTTTCCTCGTGGCTGTGGGAAGACGGGATTCGATTCCGGCAACTTGGGTGCGGACC
GGCTCGGGAGGTCAGGGGGATGACCTGCAAGCTTTCGTATCTCAACACGGAATCCGGACCGTCTGGGGGCTCATC
CCGCTGTCATACGCCGTGGACTGGCCGGCCATGGCGTCGTATAACGAGATGAGTAGCTATTGCGACTGGCTCGGG
GGCGGCGTCCGGATCCCGACTCTGGAGGAAGTAAGGAGCATACACGAGCTCGTCGACCGACGGAAGCCGAGCTAC
AAGCCGTCAAACAACAGCAAGAAGAACAAGACGACACACACGGACCCGGAAACCATCTTCACGGACCTGACGGGC
GCCAACGTCGGGCTGCAGAACTTTCACCCGGTGTCCGTCACGGACAGAGGCGCTTCTCTATGTGGATTGGGCGAT
CTGGGAGCCGACTTTATGGACGGGAAACATGTGGCCATTACCGGCGGCAGCTGGGCCCTCCCTCCGCGTATCGCC
GGCCGGAAGACTTTTCAGAACTGGTGGCAGAAGGGATATGCCTATCCGTGGGTGACAGCCAGGCTGGTGAGGGAT
TCTCCCTCGCCGAGCAGATGGCCGGGAGCAGGCTTCGCGACGCAGCGGACGGGGAAGCCTGCTCACGGGCAATTT
GTGAGGTTGCGGAACTCGTCGGCGGGGACGAGTCTGGCTTGA
Transcript >Ophcf2|00788
ATGTCCGACAAACCAAACGATTACGCATTCCCCCTTCAGGTCCTGGAGTATGCCGCGGAGCCCGTGCCTTGCATT
GAGGAGTGGAGGACGCTTTGGAAGGCCTGGGACCTCGTCACCAACATGATACCGGCCGAGGCTCTGATGGAGCAG
CCAATCCCGCTTCGGAACCCGCTCAAGTTCTACGTCGGACACATACCGACGTTCGAGGACATACACCTGGCCAGA
GCCACCGGCAAGCCGCTGACGGACCCGGCCTCGTATGCTCAGTACTTTGAACGGGGAATCGATCCCGATGTGGAC
GATCCGTCGCAGTGTCATGATCATAGCGAGCTGCCGACTGTGTGGCCGGATCTGGGCGAGATGCTCGACTACAGG
GAGAAGGTCAAGGCCCGGATACGCTCCATGTATGAGACCGGCTTGGCGTATAGGGATAGATGCGTTGGGAGAGCT
TTATGGATAGGATACGAGCACGAGGCTCTACATCTCGAAACCTTTCTCTACATGGCAATTCTCAGCCCCAACATA
CAACCTCCGCCCGGAATCCCACGGCCAGACTTTGAAAGGATGGCACGAGAGGCAGCCTCAGCACGAGTAGAGAAC
GAATGGTTTCGAATCCCCGACCAGGAACTCACCCTGGGCTACGAAGACGGCGAAAGCGACGACGGGCCGAACCGC
TTCTTCGCCTGGGACAACGAGCGGGAGCCATACGATGTCTTGGTGCCGAGTTTCGAAGCTCAAGCACGGCCTATC
TGCGTTGGCGAGTTTGCTGCTTTCCTCGTGGCTGTGGGAAGACGGGATTCGATTCCGGCAACTTGGGTGCGGACC
GGCTCGGGAGGTCAGGGGGATGACCTGCAAGCTTTCGTATCTCAACACGGAATCCGGACCGTCTGGGGGCTCATC
CCGCTGTCATACGCCGTGGACTGGCCGGCCATGGCGTCGTATAACGAGATGAGTAGCTATTGCGACTGGCTCGGG
GGCGGCGTCCGGATCCCGACTCTGGAGGAAGTAAGGAGCATACACGAGCTCGTCGACCGACGGAAGCCGAGCTAC
AAGCCGTCAAACAACAGCAAGAAGAACAAGACGACACACACGGACCCGGAAACCATCTTCACGGACCTGACGGGC
GCCAACGTCGGGCTGCAGAACTTTCACCCGGTGTCCGTCACGGACAGAGGCGCTTCTCTATGTGGATTGGGCGAT
CTGGGAGCCGACTTTATGGACGGGAAACATGTGGCCATTACCGGCGGCAGCTGGGCCCTCCCTCCGCGTATCGCC
GGCCGGAAGACTTTTCAGAACTGGTGGCAGAAGGGATATGCCTATCCGTGGGTGACAGCCAGGCTGGTGAGGGAT
TCTCCCTCGCCGAGCAGATGGCCGGGAGCAGGCTTCGCGACGCAGCGGACGGGGAAGCCTGCTCACGGGCAATTT
GTGAGGTTGCGGAACTCGTCGGCGGGGACGAGTCTGGCTTGA
Gene >Ophcf2|00788
ATGTCCGACAAACCAAACGATTACGCATTCCCCCTTCAGGTCCTGGAGTATGCCGCGGAGCCCGTGCCTTGCATT
GAGGAGTGGAGGACGCTTTGGAAGGCCTGGGACCTCGTCACCAACATGATACCGGCCGAGGCTCTGATGGAGCAG
CCAATCCCGCTTCGGAACCCGCTCAAGTTCTACGTCGGACACATACCGACGTTGTGAGTCGGCTCTTCTTGCGTA
GTCGACGAGGTCGTGAGCTTACCGTTGCCAGCGAGGACATACACCTGGCCAGAGCCACCGGCAAGCCGCTGACGG
ACCCGGCCTCGTATGCTCAGTACTTTGAACGGGGAATCGATCCCGATGTGGACGATCCGTCGCAGTGTCATGATC
ATAGCGAGCTGCCGACTGTGTGGCCGGATCTGGGCGAGATGCTCGACTACAGGGAGAAGGTCAAGGCCCGGATAC
GCTCCATGTATGAGACCGGCTTGGCGTATAGGGATAGATGCGTTGGGAGAGCTTTATGGATAGGATACGAGCACG
AGGGTAAGTTGAGTGTCTTGGAAGCTACATTGGAGAAATGTCGAGCCTCACAGCTTACTCTCACCCATCAGCTCT
ACATCTCGAAACCTTTCTCTACATGGCAATTCTCAGCCCCAACATACAACCTCCGCCCGGAATCCCACGGCCAGA
CTTTGAAAGGATGGCACGAGAGGCAGCCTCAGCACGAGTAGAGAACGAATGGTTTCGAATCCCCGACCAGGAACT
CACCCTGGGCTACGAAGACGGCGAAAGCGACGACGGGCCGAACCGCTTCTTCGCCTGGGACAACGAGCGGGAGCC
ATACGATGTCTTGGTGCCGAGTTTCGAAGCTCAAGCACGGCCTATCTGCGTTGGCGAGTTTGCTGCTTTCCTCGT
GGCTGTGGGAAGACGGGATTCGATTCCGGCAACTTGGGTGCGGACCGGCTCGGGAGGTCAGGGGGATGACCTGCA
AGCTTTCGTATCTCAACACGGAATCCGGACCGTCTGGGGGCTCATCCCGCTGTCATACGCCGTGGACTGGCCGGC
CATGGCGTCGTATAACGAGATGAGTAGCTATTGCGACTGGCTCGGGGGCGGCGTCCGGATCCCGACTCTGGAGGA
AGTAAGGAGCATACACGAGCTCGTCGACCGACGGAAGCCGAGCTACAAGCCGTCAAACAACAGCAAGAAGAACAA
GACGACACACACGGACCCGGAAACCATCTTCACGGACCTGACGGGCGCCAACGTCGGGCTGCAGAACTTTCACCC
GGTGTCCGTCACGGACAGAGGCGCTTCTCTATGTGGATTGGGCGATCTGGGAGGTGCGTGGGAGTGGACTAGCAC
GCTGTTTGCGCCGCAGCCGGGATTCAAGCCCATGGATATCTATCCAGGCTACAGTGGCGAGTCGGCCCTCGTACA
TATATATATATATATATATATATATATGAAGCTGTGAAGGAAGAGGCTGACTGACAGTTTGGACAGCCGACTTTA
TGGACGGGAAACATGTGGCCATTACCGGCGGCAGCTGGGCCCTCCCTCCGCGTATCGCCGGCCGGAAGACTTTGT
GAGTACACGTCTCACCATGGTCTAAGAGATTGGACGAAGCAGTACTGATTCTGTACTCCCGACAAAGTCAGAACT
GGTGGCAGAAGGGATATGCCTATCCGTGGGTGACAGCCAGGCTGGTGAGGGATTCTCCCTCGCCGAGCAGATGGC
CGGGAGCAGGCTTCGCGACGCAGCGGACGGGGAAGCCTGCTCACGGGCAATTTGTGAGGTTGCGGAACTCGTCGG
CGGGGACGAGTCTGGCTTGA

© 2023 - Robin Ohm - Utrecht University - The Netherlands

Built with Python Django and Wagtail