Fungal Genomics

at Utrecht University

General Properties

Protein IDOphcf2|00785
Gene name
Locationscaffold_01:2974931..2976624
Strand-
Gene length (bp)1693
Transcript length (bp)1635
Coding sequence length (bp)1635
Protein length (aa) 545

Your browser does not support drawing a protein figure.

PFAM Domains

PFAM Domain ID Short name Long name E-value Start End
PF07690 MFS_1 Major Facilitator Superfamily 6.3E-27 68 420

GO

GO Term Description Terminal node
GO:0022857 transmembrane transporter activity Yes
GO:0055085 transmembrane transport Yes
GO:0051179 localization No
GO:0008150 biological_process No
GO:0006810 transport No
GO:0009987 cellular process No
GO:0003674 molecular_function No
GO:0005215 transporter activity No
GO:0051234 establishment of localization No

SignalP

[Help with interpreting these statistics]
SignalP signal predicted Location
(based on Ymax)
D score
(significance: > 0.45)
No 1 - 36 0.45

Transmembrane Domains

Domain # Start End Length
1 61 83 22
2 98 120 22
3 129 151 22
4 161 180 19
5 187 209 22
6 219 240 21
7 260 279 19
8 289 311 22
9 324 346 22
10 366 388 22
11 395 414 19
12 424 446 22
13 459 481 22
14 506 525 19

Transcription Factor Class

(None)

Expression data

Analysis 1: Expression analysis during behavioral modification. Published in: Will et al., G3, 2020

Expression values

Label Description Expression (RPKM) Confidence interval (low) Confidence interval (high)
Fungus Fungus in pure culture 29.27 15.71 42.82
Alive In ants, during behavior modification 15.68 6.55 24.80
Dead In ants, recently dead 24.07 12.43 35.70

Differential expression

Label1 Label2 Q-value Significant difference
Alive Fungus 0.005578 yes
Alive Dead 0.028540 yes
Dead Fungus 0.377599 no

Sequences

Type of sequenceSequence
Locus Download genbank file of locus
The gene with 5 kb flanks (if sufficient flanking sequence is available). For use in cloning design programs. NOTE: features (genes or exons) that are only partially contained within the sequence are completely excluded.
Protein >Ophcf2|00785
MSKTSFDGPSQHDVSKHPPPSSSHGPKTESASPARPVSIESRGSGSRASGSREYVKPVKAYIIIVYLTLVTFMTS
VSTGLITTGIPTMAVELGIPPQTLYWPLSVYSLTTGTCLIVAGTVADVVGSRRVFLAGTLLLAGFTLGCGLSVTG
LQLTMFRAMQGIAVAMCLPTSVGILCNAIAPGRIRNVAFACTGLGQPLGFSTGLVLSGVFIKTVGWRPGWYIAAG
TLVVCVPVGLYLLPVDRLAQPPSLQRLRRRVDWPGAIIESSCFAMLAFVLVQISEDRKLIHDKTVIVLLVLSLVL
MPVFVWWMGFASKHGLPVLIPNELWARLTFSSVCIMVLMSYAVMQVLELYATLFFQKVQGLDPLQSSIRLLPSML
VGAALNLAIGLFIHRVSAMWLVFSTSLACAGSPLIMALIRPEWPYWYAAFPAQLLHPLSADVLFCVGLIVISQVF
PEDTKSLAGAVFNTVAQFGTSLGLAVIGIIASSVTEASGYQDKASPAALFQGYKAAFWATFGLTLAIAVVSIIGL
RRTGSANDVQEQGGEPSSQ*
Coding >Ophcf2|00785
ATGAGCAAAACCAGCTTCGACGGGCCGTCCCAACACGACGTCTCCAAACACCCGCCTCCCTCGTCAAGCCATGGG
CCCAAGACGGAGTCTGCCTCACCGGCCCGGCCTGTCTCGATCGAGTCCAGGGGCTCTGGGTCCCGTGCTTCCGGG
TCCAGAGAATACGTTAAGCCGGTCAAGGCCTACATCATCATCGTCTACCTGACGCTCGTAACCTTCATGACGAGC
GTCAGCACCGGCCTCATCACCACCGGCATCCCTACCATGGCCGTCGAGCTCGGAATCCCGCCCCAGACGCTGTAC
TGGCCCCTGTCCGTCTACAGCCTGACGACGGGCACGTGTCTCATCGTCGCCGGCACCGTGGCCGATGTAGTCGGC
AGTCGCCGCGTCTTCCTGGCCGGCACCCTACTCCTGGCCGGCTTCACTCTCGGCTGCGGCCTCTCGGTCACTGGC
CTTCAGCTGACCATGTTCCGCGCCATGCAGGGCATCGCCGTCGCCATGTGCCTCCCTACCTCGGTCGGTATCCTC
TGCAACGCCATCGCCCCGGGCCGAATCCGCAACGTCGCCTTCGCCTGCACCGGTTTGGGCCAACCGCTCGGCTTC
TCTACCGGCCTCGTCCTCAGCGGCGTCTTCATCAAAACGGTCGGCTGGCGGCCCGGCTGGTACATTGCTGCCGGC
ACGCTCGTCGTCTGCGTTCCCGTTGGTCTGTACCTGTTGCCTGTTGACAGGCTTGCCCAGCCGCCGTCGCTGCAG
CGGTTGAGGAGGCGGGTAGACTGGCCCGGAGCCATCATCGAGTCTTCGTGTTTCGCCATGCTGGCCTTTGTCCTG
GTGCAAATCTCAGAGGATCGCAAGCTGATCCACGACAAGACCGTCATAGTCCTGCTTGTCCTCAGCCTGGTCCTC
ATGCCCGTCTTTGTCTGGTGGATGGGCTTCGCGAGCAAGCACGGGCTGCCGGTTTTGATCCCCAACGAGCTCTGG
GCTCGCCTGACCTTCTCCAGCGTCTGCATCATGGTCCTGATGTCTTATGCCGTCATGCAGGTCCTCGAGCTCTAC
GCGACTCTCTTCTTCCAGAAAGTTCAAGGCCTGGATCCGCTTCAGTCGTCGATCCGGCTTTTACCTTCTATGCTC
GTTGGAGCCGCACTGAACCTTGCCATCGGCCTGTTCATCCATCGCGTCTCCGCCATGTGGCTCGTCTTTTCCACT
TCACTTGCCTGCGCAGGCTCGCCCCTGATAATGGCCCTGATCAGGCCGGAATGGCCGTACTGGTATGCCGCCTTT
CCAGCCCAGTTGCTGCACCCTCTTTCGGCCGATGTCCTCTTCTGCGTCGGCCTCATCGTCATCAGCCAGGTTTTC
CCAGAAGACACCAAATCGCTCGCCGGCGCCGTCTTCAACACTGTGGCCCAGTTCGGCACATCGCTAGGACTCGCA
GTCATCGGAATCATAGCGAGCTCCGTCACCGAAGCCTCGGGTTACCAAGACAAGGCGAGCCCTGCCGCCCTGTTT
CAGGGCTATAAGGCGGCCTTTTGGGCAACCTTTGGCTTGACACTCGCCATAGCCGTCGTCTCCATCATCGGCCTG
AGGAGAACGGGATCGGCGAACGATGTGCAGGAACAAGGCGGTGAACCGTCATCGCAGTAG
Transcript >Ophcf2|00785
ATGAGCAAAACCAGCTTCGACGGGCCGTCCCAACACGACGTCTCCAAACACCCGCCTCCCTCGTCAAGCCATGGG
CCCAAGACGGAGTCTGCCTCACCGGCCCGGCCTGTCTCGATCGAGTCCAGGGGCTCTGGGTCCCGTGCTTCCGGG
TCCAGAGAATACGTTAAGCCGGTCAAGGCCTACATCATCATCGTCTACCTGACGCTCGTAACCTTCATGACGAGC
GTCAGCACCGGCCTCATCACCACCGGCATCCCTACCATGGCCGTCGAGCTCGGAATCCCGCCCCAGACGCTGTAC
TGGCCCCTGTCCGTCTACAGCCTGACGACGGGCACGTGTCTCATCGTCGCCGGCACCGTGGCCGATGTAGTCGGC
AGTCGCCGCGTCTTCCTGGCCGGCACCCTACTCCTGGCCGGCTTCACTCTCGGCTGCGGCCTCTCGGTCACTGGC
CTTCAGCTGACCATGTTCCGCGCCATGCAGGGCATCGCCGTCGCCATGTGCCTCCCTACCTCGGTCGGTATCCTC
TGCAACGCCATCGCCCCGGGCCGAATCCGCAACGTCGCCTTCGCCTGCACCGGTTTGGGCCAACCGCTCGGCTTC
TCTACCGGCCTCGTCCTCAGCGGCGTCTTCATCAAAACGGTCGGCTGGCGGCCCGGCTGGTACATTGCTGCCGGC
ACGCTCGTCGTCTGCGTTCCCGTTGGTCTGTACCTGTTGCCTGTTGACAGGCTTGCCCAGCCGCCGTCGCTGCAG
CGGTTGAGGAGGCGGGTAGACTGGCCCGGAGCCATCATCGAGTCTTCGTGTTTCGCCATGCTGGCCTTTGTCCTG
GTGCAAATCTCAGAGGATCGCAAGCTGATCCACGACAAGACCGTCATAGTCCTGCTTGTCCTCAGCCTGGTCCTC
ATGCCCGTCTTTGTCTGGTGGATGGGCTTCGCGAGCAAGCACGGGCTGCCGGTTTTGATCCCCAACGAGCTCTGG
GCTCGCCTGACCTTCTCCAGCGTCTGCATCATGGTCCTGATGTCTTATGCCGTCATGCAGGTCCTCGAGCTCTAC
GCGACTCTCTTCTTCCAGAAAGTTCAAGGCCTGGATCCGCTTCAGTCGTCGATCCGGCTTTTACCTTCTATGCTC
GTTGGAGCCGCACTGAACCTTGCCATCGGCCTGTTCATCCATCGCGTCTCCGCCATGTGGCTCGTCTTTTCCACT
TCACTTGCCTGCGCAGGCTCGCCCCTGATAATGGCCCTGATCAGGCCGGAATGGCCGTACTGGTATGCCGCCTTT
CCAGCCCAGTTGCTGCACCCTCTTTCGGCCGATGTCCTCTTCTGCGTCGGCCTCATCGTCATCAGCCAGGTTTTC
CCAGAAGACACCAAATCGCTCGCCGGCGCCGTCTTCAACACTGTGGCCCAGTTCGGCACATCGCTAGGACTCGCA
GTCATCGGAATCATAGCGAGCTCCGTCACCGAAGCCTCGGGTTACCAAGACAAGGCGAGCCCTGCCGCCCTGTTT
CAGGGCTATAAGGCGGCCTTTTGGGCAACCTTTGGCTTGACACTCGCCATAGCCGTCGTCTCCATCATCGGCCTG
AGGAGAACGGGATCGGCGAACGATGTGCAGGAACAAGGCGGTGAACCGTCATCGCAGTAG
Gene >Ophcf2|00785
ATGAGCAAAACCAGCTTCGACGGGCCGTCCCAACACGACGTCTCCAAACACCCGCCTCCCTCGTCAAGCCATGGG
CCCAAGACGGAGTCTGCCTCACCGGCCCGGCCTGTCTCGATCGAGTCCAGGGGCTCTGGGTCCCGTGCTTCCGGG
TCCAGAGAATACGTTAAGCCGGTCAAGGCCTACATCATCATCGTCTACCTGACGCTCGTAACCTTCATGACGAGC
GTCAGCACCGGCCTCATCACCACCGGCATCCCTACCATGGCCGTCGAGCTCGGAATCCCGCCCCAGACGCTGTAC
TGGCCCCTGTCCGTCTACAGCCTGACGACGGGCACGTGTCTCATCGTCGCCGGCACCGTGGCCGATGTAGTCGGC
AGTCGCCGCGTCTTCCTGGCCGGCACCCTACTCCTGGCCGGCTTCACTCTCGGCTGCGGCCTCTCGGTCACTGGC
CTTCAGCTGACCATGTTCCGCGCCATGCAGGGCATCGCCGTCGCCATGTGCCTCCCTACCTCGGTCGGTATCCTC
TGCAACGCCATCGCCCCGGGCCGAATCCGCAACGTCGCCTTCGCCTGCACCGGTTTGGGCCAACCGCTCGGCTTC
TCTACCGGCCTCGTCCTCAGCGGCGTCTTCATCAAAACGGTCGGCTGGCGGCCCGGCTGGTACATTGCTGCCGGC
ACGCTCGTCGTCTGCGTTCCCGTTGGTCTGTACCTGTTGCCTGTTGACAGGCTTGCCCAGCCGCCGTCGCTGCAG
CGGTTGAGGAGGCGGGTAGACTGGCCCGGAGCCATCATCGAGTCTTCGTGTTTCGCCATGCTGGCCTTTGTCCTG
GTGCAAATCTCAGAGGATCGCAAGCTGATCCACGACAAGACCGTCATAGTCCTGCTTGTCCTCAGCCTGGTCCTC
ATGCCCGTCTTTGTCTGGTGGATGGGCTTCGCGAGCAAGCACGGGCTGCCGGTTTTGATCCCCAACGAGCTCTGG
GCTCGCCTGACCTTCTCCAGCGTCTGCATCATGGTCCTGATGTCTTATGCCGTCATGCAGGTCCTCGAGCTCTAC
GCGACTCTCTTCTTCCAGAAAGTTCAAGGCCTGGATCCGCTTCAGTCGTCGATCCGGCTTTTACCTTCTATGCTC
GTTGGAGCCGCACTGAACCTTGCCATCGGCCTGTTCATCCATCGCGTCTCCGCCATGTGGCTCGTCTTTTCCACT
TCACTTGCCTGCGCAGGCTCGCCCCTGATAATGGCCCTGATCAGGCCGGAATGGCCGTACTGGTATGCCGCCTTT
CCAGCCCAGTTGCTGCACCCTGTGAGTATCTGATCAACTTGCGCTGTTCCCTTTGCTTTCCTTCTGACGTTCTGA
GTAGCTTTCGGCCGATGTCCTCTTCTGCGTCGGCCTCATCGTCATCAGCCAGGTTTTCCCAGAAGACACCAAATC
GCTCGCCGGCGCCGTCTTCAACACTGTGGCCCAGTTCGGCACATCGCTAGGACTCGCAGTCATCGGAATCATAGC
GAGCTCCGTCACCGAAGCCTCGGGTTACCAAGACAAGGCGAGCCCTGCCGCCCTGTTTCAGGGCTATAAGGCGGC
CTTTTGGGCAACCTTTGGCTTGACACTCGCCATAGCCGTCGTCTCCATCATCGGCCTGAGGAGAACGGGATCGGC
GAACGATGTGCAGGAACAAGGCGGTGAACCGTCATCGCAGTAG

© 2022 - Robin Ohm - Utrecht University - The Netherlands

Built with Python Django and Wagtail