Fungal Genomics

at Utrecht University

General Properties

Protein IDOphcf2|00785
Gene name
Locationscaffold_01:2974931..2976624
Strand-
Gene length (bp)1693
Transcript length (bp)1635
Coding sequence length (bp)1635
Protein length (aa) 545

Your browser does not support drawing a protein figure.

PFAM Domains

PFAM Domain ID Short name Long name E-value Start End
PF07690 MFS_1 Major Facilitator Superfamily 6.3E-27 68 420

GO

GO Term Description Terminal node
GO:0022857 transmembrane transporter activity Yes
GO:0055085 transmembrane transport Yes
GO:0051179 localization No
GO:0008150 biological_process No
GO:0006810 transport No
GO:0009987 cellular process No
GO:0003674 molecular_function No
GO:0005215 transporter activity No
GO:0051234 establishment of localization No

SignalP

[Help with interpreting these statistics]
SignalP signal predicted Location
(based on Ymax)
D score
(significance: > 0.45)
No 1 - 36 0.45

Transmembrane Domains

Domain # Start End Length
1 61 83 22
2 98 120 22
3 129 151 22
4 161 180 19
5 187 209 22
6 219 240 21
7 260 279 19
8 289 311 22
9 324 346 22
10 366 388 22
11 395 414 19
12 424 446 22
13 459 481 22
14 506 525 19

Transcription Factor Class

(None)

Expression data

Analysis 1: Expression analysis during behavioral modification. Published in: Will et al., G3, 2020

Click here for more information

Sequences

Type of sequenceSequence
Locus Download genbank file of locus
The gene with 5 kb flanks (if sufficient flanking sequence is available). For use in cloning design programs. NOTE: features (genes or exons) that are only partially contained within the sequence are completely excluded.
Protein >Ophcf2|00785
MSKTSFDGPSQHDVSKHPPPSSSHGPKTESASPARPVSIESRGSGSRASGSREYVKPVKAYIIIVYLTLVTFMTS
VSTGLITTGIPTMAVELGIPPQTLYWPLSVYSLTTGTCLIVAGTVADVVGSRRVFLAGTLLLAGFTLGCGLSVTG
LQLTMFRAMQGIAVAMCLPTSVGILCNAIAPGRIRNVAFACTGLGQPLGFSTGLVLSGVFIKTVGWRPGWYIAAG
TLVVCVPVGLYLLPVDRLAQPPSLQRLRRRVDWPGAIIESSCFAMLAFVLVQISEDRKLIHDKTVIVLLVLSLVL
MPVFVWWMGFASKHGLPVLIPNELWARLTFSSVCIMVLMSYAVMQVLELYATLFFQKVQGLDPLQSSIRLLPSML
VGAALNLAIGLFIHRVSAMWLVFSTSLACAGSPLIMALIRPEWPYWYAAFPAQLLHPLSADVLFCVGLIVISQVF
PEDTKSLAGAVFNTVAQFGTSLGLAVIGIIASSVTEASGYQDKASPAALFQGYKAAFWATFGLTLAIAVVSIIGL
RRTGSANDVQEQGGEPSSQ*
Coding >Ophcf2|00785
ATGAGCAAAACCAGCTTCGACGGGCCGTCCCAACACGACGTCTCCAAACACCCGCCTCCCTCGTCAAGCCATGGG
CCCAAGACGGAGTCTGCCTCACCGGCCCGGCCTGTCTCGATCGAGTCCAGGGGCTCTGGGTCCCGTGCTTCCGGG
TCCAGAGAATACGTTAAGCCGGTCAAGGCCTACATCATCATCGTCTACCTGACGCTCGTAACCTTCATGACGAGC
GTCAGCACCGGCCTCATCACCACCGGCATCCCTACCATGGCCGTCGAGCTCGGAATCCCGCCCCAGACGCTGTAC
TGGCCCCTGTCCGTCTACAGCCTGACGACGGGCACGTGTCTCATCGTCGCCGGCACCGTGGCCGATGTAGTCGGC
AGTCGCCGCGTCTTCCTGGCCGGCACCCTACTCCTGGCCGGCTTCACTCTCGGCTGCGGCCTCTCGGTCACTGGC
CTTCAGCTGACCATGTTCCGCGCCATGCAGGGCATCGCCGTCGCCATGTGCCTCCCTACCTCGGTCGGTATCCTC
TGCAACGCCATCGCCCCGGGCCGAATCCGCAACGTCGCCTTCGCCTGCACCGGTTTGGGCCAACCGCTCGGCTTC
TCTACCGGCCTCGTCCTCAGCGGCGTCTTCATCAAAACGGTCGGCTGGCGGCCCGGCTGGTACATTGCTGCCGGC
ACGCTCGTCGTCTGCGTTCCCGTTGGTCTGTACCTGTTGCCTGTTGACAGGCTTGCCCAGCCGCCGTCGCTGCAG
CGGTTGAGGAGGCGGGTAGACTGGCCCGGAGCCATCATCGAGTCTTCGTGTTTCGCCATGCTGGCCTTTGTCCTG
GTGCAAATCTCAGAGGATCGCAAGCTGATCCACGACAAGACCGTCATAGTCCTGCTTGTCCTCAGCCTGGTCCTC
ATGCCCGTCTTTGTCTGGTGGATGGGCTTCGCGAGCAAGCACGGGCTGCCGGTTTTGATCCCCAACGAGCTCTGG
GCTCGCCTGACCTTCTCCAGCGTCTGCATCATGGTCCTGATGTCTTATGCCGTCATGCAGGTCCTCGAGCTCTAC
GCGACTCTCTTCTTCCAGAAAGTTCAAGGCCTGGATCCGCTTCAGTCGTCGATCCGGCTTTTACCTTCTATGCTC
GTTGGAGCCGCACTGAACCTTGCCATCGGCCTGTTCATCCATCGCGTCTCCGCCATGTGGCTCGTCTTTTCCACT
TCACTTGCCTGCGCAGGCTCGCCCCTGATAATGGCCCTGATCAGGCCGGAATGGCCGTACTGGTATGCCGCCTTT
CCAGCCCAGTTGCTGCACCCTCTTTCGGCCGATGTCCTCTTCTGCGTCGGCCTCATCGTCATCAGCCAGGTTTTC
CCAGAAGACACCAAATCGCTCGCCGGCGCCGTCTTCAACACTGTGGCCCAGTTCGGCACATCGCTAGGACTCGCA
GTCATCGGAATCATAGCGAGCTCCGTCACCGAAGCCTCGGGTTACCAAGACAAGGCGAGCCCTGCCGCCCTGTTT
CAGGGCTATAAGGCGGCCTTTTGGGCAACCTTTGGCTTGACACTCGCCATAGCCGTCGTCTCCATCATCGGCCTG
AGGAGAACGGGATCGGCGAACGATGTGCAGGAACAAGGCGGTGAACCGTCATCGCAGTAG
Transcript >Ophcf2|00785
ATGAGCAAAACCAGCTTCGACGGGCCGTCCCAACACGACGTCTCCAAACACCCGCCTCCCTCGTCAAGCCATGGG
CCCAAGACGGAGTCTGCCTCACCGGCCCGGCCTGTCTCGATCGAGTCCAGGGGCTCTGGGTCCCGTGCTTCCGGG
TCCAGAGAATACGTTAAGCCGGTCAAGGCCTACATCATCATCGTCTACCTGACGCTCGTAACCTTCATGACGAGC
GTCAGCACCGGCCTCATCACCACCGGCATCCCTACCATGGCCGTCGAGCTCGGAATCCCGCCCCAGACGCTGTAC
TGGCCCCTGTCCGTCTACAGCCTGACGACGGGCACGTGTCTCATCGTCGCCGGCACCGTGGCCGATGTAGTCGGC
AGTCGCCGCGTCTTCCTGGCCGGCACCCTACTCCTGGCCGGCTTCACTCTCGGCTGCGGCCTCTCGGTCACTGGC
CTTCAGCTGACCATGTTCCGCGCCATGCAGGGCATCGCCGTCGCCATGTGCCTCCCTACCTCGGTCGGTATCCTC
TGCAACGCCATCGCCCCGGGCCGAATCCGCAACGTCGCCTTCGCCTGCACCGGTTTGGGCCAACCGCTCGGCTTC
TCTACCGGCCTCGTCCTCAGCGGCGTCTTCATCAAAACGGTCGGCTGGCGGCCCGGCTGGTACATTGCTGCCGGC
ACGCTCGTCGTCTGCGTTCCCGTTGGTCTGTACCTGTTGCCTGTTGACAGGCTTGCCCAGCCGCCGTCGCTGCAG
CGGTTGAGGAGGCGGGTAGACTGGCCCGGAGCCATCATCGAGTCTTCGTGTTTCGCCATGCTGGCCTTTGTCCTG
GTGCAAATCTCAGAGGATCGCAAGCTGATCCACGACAAGACCGTCATAGTCCTGCTTGTCCTCAGCCTGGTCCTC
ATGCCCGTCTTTGTCTGGTGGATGGGCTTCGCGAGCAAGCACGGGCTGCCGGTTTTGATCCCCAACGAGCTCTGG
GCTCGCCTGACCTTCTCCAGCGTCTGCATCATGGTCCTGATGTCTTATGCCGTCATGCAGGTCCTCGAGCTCTAC
GCGACTCTCTTCTTCCAGAAAGTTCAAGGCCTGGATCCGCTTCAGTCGTCGATCCGGCTTTTACCTTCTATGCTC
GTTGGAGCCGCACTGAACCTTGCCATCGGCCTGTTCATCCATCGCGTCTCCGCCATGTGGCTCGTCTTTTCCACT
TCACTTGCCTGCGCAGGCTCGCCCCTGATAATGGCCCTGATCAGGCCGGAATGGCCGTACTGGTATGCCGCCTTT
CCAGCCCAGTTGCTGCACCCTCTTTCGGCCGATGTCCTCTTCTGCGTCGGCCTCATCGTCATCAGCCAGGTTTTC
CCAGAAGACACCAAATCGCTCGCCGGCGCCGTCTTCAACACTGTGGCCCAGTTCGGCACATCGCTAGGACTCGCA
GTCATCGGAATCATAGCGAGCTCCGTCACCGAAGCCTCGGGTTACCAAGACAAGGCGAGCCCTGCCGCCCTGTTT
CAGGGCTATAAGGCGGCCTTTTGGGCAACCTTTGGCTTGACACTCGCCATAGCCGTCGTCTCCATCATCGGCCTG
AGGAGAACGGGATCGGCGAACGATGTGCAGGAACAAGGCGGTGAACCGTCATCGCAGTAG
Gene >Ophcf2|00785
ATGAGCAAAACCAGCTTCGACGGGCCGTCCCAACACGACGTCTCCAAACACCCGCCTCCCTCGTCAAGCCATGGG
CCCAAGACGGAGTCTGCCTCACCGGCCCGGCCTGTCTCGATCGAGTCCAGGGGCTCTGGGTCCCGTGCTTCCGGG
TCCAGAGAATACGTTAAGCCGGTCAAGGCCTACATCATCATCGTCTACCTGACGCTCGTAACCTTCATGACGAGC
GTCAGCACCGGCCTCATCACCACCGGCATCCCTACCATGGCCGTCGAGCTCGGAATCCCGCCCCAGACGCTGTAC
TGGCCCCTGTCCGTCTACAGCCTGACGACGGGCACGTGTCTCATCGTCGCCGGCACCGTGGCCGATGTAGTCGGC
AGTCGCCGCGTCTTCCTGGCCGGCACCCTACTCCTGGCCGGCTTCACTCTCGGCTGCGGCCTCTCGGTCACTGGC
CTTCAGCTGACCATGTTCCGCGCCATGCAGGGCATCGCCGTCGCCATGTGCCTCCCTACCTCGGTCGGTATCCTC
TGCAACGCCATCGCCCCGGGCCGAATCCGCAACGTCGCCTTCGCCTGCACCGGTTTGGGCCAACCGCTCGGCTTC
TCTACCGGCCTCGTCCTCAGCGGCGTCTTCATCAAAACGGTCGGCTGGCGGCCCGGCTGGTACATTGCTGCCGGC
ACGCTCGTCGTCTGCGTTCCCGTTGGTCTGTACCTGTTGCCTGTTGACAGGCTTGCCCAGCCGCCGTCGCTGCAG
CGGTTGAGGAGGCGGGTAGACTGGCCCGGAGCCATCATCGAGTCTTCGTGTTTCGCCATGCTGGCCTTTGTCCTG
GTGCAAATCTCAGAGGATCGCAAGCTGATCCACGACAAGACCGTCATAGTCCTGCTTGTCCTCAGCCTGGTCCTC
ATGCCCGTCTTTGTCTGGTGGATGGGCTTCGCGAGCAAGCACGGGCTGCCGGTTTTGATCCCCAACGAGCTCTGG
GCTCGCCTGACCTTCTCCAGCGTCTGCATCATGGTCCTGATGTCTTATGCCGTCATGCAGGTCCTCGAGCTCTAC
GCGACTCTCTTCTTCCAGAAAGTTCAAGGCCTGGATCCGCTTCAGTCGTCGATCCGGCTTTTACCTTCTATGCTC
GTTGGAGCCGCACTGAACCTTGCCATCGGCCTGTTCATCCATCGCGTCTCCGCCATGTGGCTCGTCTTTTCCACT
TCACTTGCCTGCGCAGGCTCGCCCCTGATAATGGCCCTGATCAGGCCGGAATGGCCGTACTGGTATGCCGCCTTT
CCAGCCCAGTTGCTGCACCCTGTGAGTATCTGATCAACTTGCGCTGTTCCCTTTGCTTTCCTTCTGACGTTCTGA
GTAGCTTTCGGCCGATGTCCTCTTCTGCGTCGGCCTCATCGTCATCAGCCAGGTTTTCCCAGAAGACACCAAATC
GCTCGCCGGCGCCGTCTTCAACACTGTGGCCCAGTTCGGCACATCGCTAGGACTCGCAGTCATCGGAATCATAGC
GAGCTCCGTCACCGAAGCCTCGGGTTACCAAGACAAGGCGAGCCCTGCCGCCCTGTTTCAGGGCTATAAGGCGGC
CTTTTGGGCAACCTTTGGCTTGACACTCGCCATAGCCGTCGTCTCCATCATCGGCCTGAGGAGAACGGGATCGGC
GAACGATGTGCAGGAACAAGGCGGTGAACCGTCATCGCAGTAG

© 2022 - Robin Ohm - Utrecht University - The Netherlands

Built with Python Django and Wagtail