Fungal Genomics

at Utrecht University

General Properties

Protein IDOphcf2|00782
Gene name
Locationscaffold_01:2967313..2969047
Strand-
Gene length (bp)1734
Transcript length (bp)1626
Coding sequence length (bp)1626
Protein length (aa) 542

Overview

Your browser does not support drawing a protein figure.

PFAM Domains

(None)

GO

(None)

Deeploc

[Help with interpreting the results of Deeploc 2.0]
Localizations Signals Cytoplasm Nucleus Extracellular Cell membrane Mitochondrion Plastid Endoplasmic reticulum Lysosome vacuole Golgi apparatus Peroxisome
Nucleus Nuclear localization signal 0.4316 0.639 0.0838 0.2402 0.1113 0.0098 0.0186 0.0239 0.0038 0.0008

SignalP

(None)

Transmembrane Domains

(None)

Transcription Factor Class

(None)

CAZymes

(None)

Secondary Metabolism

(None)

Expression data

Analysis 1: Expression analysis during behavioral modification. Published in: Will et al., G3, 2020

Click here for more information

Orthologs

Orthofinder run ID4
Orthogroup2549
Change Orthofinder run
Species Protein ID
Ophiocordyceps australis 1348a (Ghana) OphauG2|2241
Ophiocordyceps australis map64 (Brazil) OphauB2|5099
Ophiocordyceps camponoti-floridani Ophcf2|00782 (this protein)
Ophiocordyceps camponoti-rufipedis Ophun1|5258
Ophiocordyceps kimflemingae Ophio5|2610
Ophiocordyceps subramaniannii Hirsu2|3776

Sequences

Type of sequenceSequence
Locus Download genbank file of locus Download genbank file of locus (reverse complement)
The gene with 5 kb flanks (if sufficient flanking sequence is available). For use in cloning design programs. NOTE: features (genes or exons) that are only partially contained within the sequence are completely excluded.
Protein >Ophcf2|00782
MAHRSSRMTDFEERDYYAAPRRPAADLDDRDYRPRAGPRSRVATSEYDEVDVRLRDRELDRTPGFLRDEGRRPEA
GPMVLRQRDIETIDRHARSPSPPPVRRREMVRRPKSTSPPTMRGSEHENIHTRIVERERDRVRSPSVVRCRSPSP
LPVRFVERRRRSPSPVSQHDHIRIVERERQRVPSPSPSPSPPPAPAIIRGPTIERDVITHWTDVDHGVVRAKPPS
PRARSRPRERETDIDISLSKDRTEVDIHQSNSRPRSKSRERRSRFHEDDVVVRRDGNRLRVDEYSGPRRRAQSAA
PLCSPAEEEAEYLTSKIDTRGRMGEAWGGVTKDWCIVDVPPGTERVRMDGVGGASTDTTWSRYSGVRRTQFNSER
DGVLVPREPSPAPSRDRASAYDREREIDVDIDRRVTRTPLPPPQPPAPAKELWTEITKDLIVREAIEQQGYEYEE
TKCFFYIMDYLRFEDVLRLTELSKSIRRARKERAREIEWERDWRDEWERPFRRPMHDHHDHHRSREEWDDERVRE
REFVYDSRRPNRGYLR*
Coding >Ophcf2|00782
ATGGCCCACCGAAGCTCTAGGATGACCGACTTCGAGGAGCGCGACTATTATGCCGCACCTCGACGTCCGGCTGCT
GACCTGGACGACCGCGACTATCGTCCTCGTGCCGGCCCGCGGTCCCGTGTGGCGACGAGTGAGTACGACGAGGTT
GACGTCAGGCTGCGTGACCGCGAGCTGGATCGTACACCGGGCTTCTTAAGAGATGAAGGTCGTCGTCCAGAAGCT
GGCCCCATGGTTCTGCGCCAGCGAGATATCGAGACCATCGATCGTCACGCCCGAAGCCCCAGTCCTCCTCCCGTT
CGTCGACGCGAGATGGTCCGTCGGCCGAAGAGCACTTCCCCGCCTACGATGCGCGGCAGCGAGCATGAAAATATC
CATACCAGGATTGTCGAGAGGGAGCGCGATAGAGTCAGAAGTCCGTCTGTCGTCCGCTGTCGATCTCCGTCTCCG
CTGCCTGTAAGATTCGTCGAGCGCCGCCGTCGCTCTCCGTCGCCCGTGAGCCAGCACGATCATATCCGCATCGTC
GAGAGGGAGAGGCAGCGTGTTCCATCGCCATCGCCGTCACCCTCGCCTCCGCCAGCTCCGGCCATCATTCGCGGC
CCGACGATTGAGCGAGATGTCATCACTCACTGGACCGACGTCGACCACGGCGTCGTCCGGGCCAAACCACCGAGC
CCGAGGGCCCGTTCGCGTCCCAGGGAGCGGGAGACGGATATTGATATTTCCCTTTCCAAGGACCGGACAGAGGTC
GATATTCATCAGTCCAACAGCCGTCCACGCTCCAAGAGTCGTGAGCGTCGGTCACGCTTCCACGAAGATGACGTC
GTCGTCCGCCGCGATGGCAACCGGCTCCGGGTGGACGAGTATTCGGGCCCGCGCCGACGAGCCCAGTCAGCCGCT
CCGCTTTGCTCGCCGGCCGAAGAAGAGGCCGAATACCTCACGTCCAAGATCGACACTCGAGGCCGCATGGGCGAG
GCCTGGGGCGGTGTAACCAAGGATTGGTGTATTGTTGATGTCCCGCCGGGGACCGAGAGGGTTCGTATGGACGGC
GTCGGGGGCGCCAGCACCGACACGACCTGGTCGAGGTACAGCGGCGTCAGGCGAACGCAGTTCAACTCCGAGAGA
GACGGGGTTCTCGTACCCAGAGAGCCGTCGCCCGCTCCTTCGCGGGATCGCGCCAGCGCTTACGACCGCGAGAGG
GAAATTGACGTTGATATCGATCGAAGGGTGACTCGCACGCCCTTGCCGCCTCCGCAACCCCCGGCGCCGGCCAAG
GAGCTATGGACTGAGATTACCAAGGACCTCATTGTTCGAGAAGCCATCGAGCAGCAGGGCTACGAGTATGAAGAG
ACCAAGTGTTTCTTTTACATTATGGACTATCTTCGTTTTGAAGATGTCCTTCGCCTGACGGAGCTGTCGAAAAGC
ATCCGCCGGGCTCGAAAGGAGCGCGCGCGCGAGATCGAATGGGAGCGGGACTGGCGGGACGAATGGGAGCGGCCT
TTCCGACGCCCCATGCACGACCATCACGACCACCATCGTTCACGGGAGGAGTGGGACGACGAGCGGGTGAGGGAG
CGCGAATTCGTCTACGACAGCCGCCGACCGAACCGCGGATATCTCCGATGA
Transcript >Ophcf2|00782
ATGGCCCACCGAAGCTCTAGGATGACCGACTTCGAGGAGCGCGACTATTATGCCGCACCTCGACGTCCGGCTGCT
GACCTGGACGACCGCGACTATCGTCCTCGTGCCGGCCCGCGGTCCCGTGTGGCGACGAGTGAGTACGACGAGGTT
GACGTCAGGCTGCGTGACCGCGAGCTGGATCGTACACCGGGCTTCTTAAGAGATGAAGGTCGTCGTCCAGAAGCT
GGCCCCATGGTTCTGCGCCAGCGAGATATCGAGACCATCGATCGTCACGCCCGAAGCCCCAGTCCTCCTCCCGTT
CGTCGACGCGAGATGGTCCGTCGGCCGAAGAGCACTTCCCCGCCTACGATGCGCGGCAGCGAGCATGAAAATATC
CATACCAGGATTGTCGAGAGGGAGCGCGATAGAGTCAGAAGTCCGTCTGTCGTCCGCTGTCGATCTCCGTCTCCG
CTGCCTGTAAGATTCGTCGAGCGCCGCCGTCGCTCTCCGTCGCCCGTGAGCCAGCACGATCATATCCGCATCGTC
GAGAGGGAGAGGCAGCGTGTTCCATCGCCATCGCCGTCACCCTCGCCTCCGCCAGCTCCGGCCATCATTCGCGGC
CCGACGATTGAGCGAGATGTCATCACTCACTGGACCGACGTCGACCACGGCGTCGTCCGGGCCAAACCACCGAGC
CCGAGGGCCCGTTCGCGTCCCAGGGAGCGGGAGACGGATATTGATATTTCCCTTTCCAAGGACCGGACAGAGGTC
GATATTCATCAGTCCAACAGCCGTCCACGCTCCAAGAGTCGTGAGCGTCGGTCACGCTTCCACGAAGATGACGTC
GTCGTCCGCCGCGATGGCAACCGGCTCCGGGTGGACGAGTATTCGGGCCCGCGCCGACGAGCCCAGTCAGCCGCT
CCGCTTTGCTCGCCGGCCGAAGAAGAGGCCGAATACCTCACGTCCAAGATCGACACTCGAGGCCGCATGGGCGAG
GCCTGGGGCGGTGTAACCAAGGATTGGTGTATTGTTGATGTCCCGCCGGGGACCGAGAGGGTTCGTATGGACGGC
GTCGGGGGCGCCAGCACCGACACGACCTGGTCGAGGTACAGCGGCGTCAGGCGAACGCAGTTCAACTCCGAGAGA
GACGGGGTTCTCGTACCCAGAGAGCCGTCGCCCGCTCCTTCGCGGGATCGCGCCAGCGCTTACGACCGCGAGAGG
GAAATTGACGTTGATATCGATCGAAGGGTGACTCGCACGCCCTTGCCGCCTCCGCAACCCCCGGCGCCGGCCAAG
GAGCTATGGACTGAGATTACCAAGGACCTCATTGTTCGAGAAGCCATCGAGCAGCAGGGCTACGAGTATGAAGAG
ACCAAGTGTTTCTTTTACATTATGGACTATCTTCGTTTTGAAGATGTCCTTCGCCTGACGGAGCTGTCGAAAAGC
ATCCGCCGGGCTCGAAAGGAGCGCGCGCGCGAGATCGAATGGGAGCGGGACTGGCGGGACGAATGGGAGCGGCCT
TTCCGACGCCCCATGCACGACCATCACGACCACCATCGTTCACGGGAGGAGTGGGACGACGAGCGGGTGAGGGAG
CGCGAATTCGTCTACGACAGCCGCCGACCGAACCGCGGATATCTCCGATGA
Gene >Ophcf2|00782
ATGGCCCACCGAAGCTCTAGGATGACCGACTTCGAGGAGCGCGACTATTATGCCGCACCTCGACGTCCGGCTGCT
GACCTGGACGACCGCGACTATCGTCCTCGTGCCGGCCCGCGGTCCCGTGTGGCGACGAGTGAGTACGACGAGGTT
GACGTCAGGCTGCGTGACCGCGAGCTGGATCGTACACCGGGCTTCTTAAGAGATGAAGGTCGTCGTCCAGAAGCT
GGCCCCATGGTTCTGCGCCAGCGAGATATCGAGACCATCGATCGTCACGCCCGAAGCCCCAGTCCTCCTCCCGTT
CGTCGACGCGAGATGGTCCGTCGGCCGAAGAGCACTTCCCCGCCTACGATGCGCGGCAGCGAGCATGAAAATATC
CATACCAGGATTGTCGAGAGGGAGCGCGATAGAGTCAGAAGTCCGTCTGTCGTCCGCTGTCGATCTCCGTCTCCG
CTGCCTGTAAGATTCGTCGAGCGCCGCCGTCGCTCTCCGTCGCCCGTGAGCCAGCACGATCATATCCGCATCGTC
GAGAGGGAGAGGCAGCGTGTTCCATCGCCATCGCCGTCACCCTCGCCTCCGCCAGCTCCGGCCATCATTCGCGGC
CCGACGATTGAGCGAGATGTCATCACTCACTGGACCGACGTCGACCACGGTGAGTCTTGTGTTTACTCGGCTTCT
GGATATTGCTGATTACAACATCGCAGGCGTCGTCCGGGCCAAACCACCGAGCCCGAGGGCCCGTTCGCGTCCCAG
GGAGCGGGAGACGGATATTGATATTTCCCTTTCCAAGGACCGGACAGAGGTCGATATTCATCAGTCCAACAGCCG
TCCACGCTCCAAGAGTCGTGAGCGTCGGTCACGCTTCCACGAAGATGACGTCGTCGTCCGCCGCGATGGCAACCG
GCTCCGGGTGGACGAGTATTCGGGCCCGCGCCGACGAGCCCAGTCAGCCGCTCCGCTTTGCTCGCCGGCCGAAGA
AGAGGCCGAATACCTCACGTCCAAGATCGACACTCGAGGCCGCATGGGCGAGGCCTGGGGCGGTGTAACCAAGGA
TTGGTGTATTGTTGATGTCCCGCCGGGGACCGAGAGGGTTCGTATGGACGGCGTCGGGGGCGCCAGCACCGACAC
GACCTGGTCGAGGTACAGCGGCGTCAGGCGAACGCAGTTCAACTCCGAGAGAGACGGGGTTCTCGTACCCAGAGA
GCCGTCGCCCGCTCCTTCGCGGGATCGCGCCAGCGCTTACGACCGCGAGAGGGAAATTGACGTTGATATCGATCG
AAGGGTGACTCGCACGCCCTTGCCGCCTCCGCAACCCCCGGCGCCGGCCAAGGAGCTATGGACTGAGATTACCAA
GGACCTCATTGTTCGAGAAGCCATCGAGCAGCAGGGCTACGAGTATGAAGAGACCAAGTGTTTCTTTTACATTAT
GGACTATCTTCGTTTTGTGAGTTGTTGATTGGACGCGTTCTGAAGCAGGGCAGGCAGCTGACCGCCATACAGGAA
GATGTCCTTCGCCTGACGGAGCTGTCGAAAAGCATCCGCCGGGCTCGAAAGGAGCGCGCGCGCGAGATCGAATGG
GAGCGGGACTGGCGGGACGAATGGGAGCGGCCTTTCCGACGCCCCATGCACGACCATCACGACCACCATCGTTCA
CGGGAGGAGTGGGACGACGAGCGGGTGAGGGAGCGCGAATTCGTCTACGACAGCCGCCGACCGAACCGCGGATAT
CTCCGATGA

© 2023 - Robin Ohm - Utrecht University - The Netherlands

Built with Python Django and Wagtail