Fungal Genomics

at Utrecht University

General Properties

Protein IDOphcf2|00778
Gene name
Locationscaffold_01:2945924..2949954
Strand-
Gene length (bp)4030
Transcript length (bp)3456
Coding sequence length (bp)3456
Protein length (aa) 1152

Overview

Your browser does not support drawing a protein figure.

PFAM Domains

PFAM Domain ID Short name Long name E-value Start End
PF10156 Med17 Subunit 17 of Mediator complex 3.1E-84 523 931
PF01565 FAD_binding_4 FAD binding domain 1.5E-19 24 169
PF08031 BBE Berberine and berberine like 2.9E-09 413 449

GO

GO Term Description Terminal node
GO:0006357 regulation of transcription by RNA polymerase II Yes
GO:0016491 oxidoreductase activity Yes
GO:0050660 flavin adenine dinucleotide binding Yes
GO:0016592 mediator complex Yes
GO:0003712 transcription coregulator activity Yes
GO:0140110 transcription regulator activity No
GO:0031323 regulation of cellular metabolic process No
GO:0032991 protein-containing complex No
GO:0010556 regulation of macromolecule biosynthetic process No
GO:1901265 nucleoside phosphate binding No
GO:0005488 binding No
GO:0031326 regulation of cellular biosynthetic process No
GO:0043168 anion binding No
GO:1901363 heterocyclic compound binding No
GO:0006355 regulation of transcription, DNA-templated No
GO:0019219 regulation of nucleobase-containing compound metabolic process No
GO:0050789 regulation of biological process No
GO:0097159 organic cyclic compound binding No
GO:0080090 regulation of primary metabolic process No
GO:0050794 regulation of cellular process No
GO:0019222 regulation of metabolic process No
GO:0009889 regulation of biosynthetic process No
GO:0008150 biological_process No
GO:0010468 regulation of gene expression No
GO:0043167 ion binding No
GO:0060255 regulation of macromolecule metabolic process No
GO:0036094 small molecule binding No
GO:0065007 biological regulation No
GO:2001141 regulation of RNA biosynthetic process No
GO:0003824 catalytic activity No
GO:0000166 nucleotide binding No
GO:0051252 regulation of RNA metabolic process No
GO:1903506 regulation of nucleic acid-templated transcription No
GO:0003674 molecular_function No
GO:0140513 nuclear protein-containing complex No
GO:0005575 cellular_component No
GO:0051171 regulation of nitrogen compound metabolic process No

Deeploc

[Help with interpreting the results of Deeploc 2.0]
Localizations Signals Cytoplasm Nucleus Extracellular Cell membrane Mitochondrion Plastid Endoplasmic reticulum Lysosome vacuole Golgi apparatus Peroxisome
Cytoplasm 0.5066 0.5187 0.2148 0.0858 0.2629 0.0752 0.1287 0.1631 0.1117 0.2651

SignalP

(None)

Transmembrane Domains

(None)

Transcription Factor Class

(None)

CAZymes

CAZyme category E-value Start End
AA7 1.7E-46 21 216

Secondary Metabolism

(None)

Expression data

Analysis 1: Expression analysis during behavioral modification. Published in: Will et al., G3, 2020

Click here for more information

Orthologs

Orthofinder run ID4
Orthogroup133
Change Orthofinder run
Species Protein ID
Ophiocordyceps australis 1348a (Ghana) OphauG2|7793
Ophiocordyceps australis map64 (Brazil) OphauB2|5097
Ophiocordyceps camponoti-floridani Ophcf2|00778 (this protein)
Ophiocordyceps camponoti-floridani Ophcf2|03867
Ophiocordyceps camponoti-rufipedis Ophun1|5948
Ophiocordyceps camponoti-rufipedis Ophun1|6363
Ophiocordyceps kimflemingae Ophio5|1641
Ophiocordyceps kimflemingae Ophio5|2605
Ophiocordyceps kimflemingae Ophio5|3904
Ophiocordyceps subramaniannii Hirsu2|10680
Ophiocordyceps subramaniannii Hirsu2|1755
Ophiocordyceps subramaniannii Hirsu2|6804
Ophiocordyceps subramaniannii Hirsu2|9391

Sequences

Type of sequenceSequence
Locus Download genbank file of locus Download genbank file of locus (reverse complement)
The gene with 5 kb flanks (if sufficient flanking sequence is available). For use in cloning design programs. NOTE: features (genes or exons) that are only partially contained within the sequence are completely excluded.
Protein >Ophcf2|00778
MWDQFTNYSCLPDANAPCTARGYPPYVINASTAGHVKTGIDFARNHNIRLVVKNSGHDFIGRSVAPGALSIWAHN
LNSIKFKPDELQLDGSNRIIKTNSLTVGGGVQMFDAYKAADQHGQTITGGGGKSVSFGGYVSGGGHSFVAPYLGL
AADNILQMEVVTPAGDIIAVNEDRYPDLFWALRGGGGSTFGVITSLTIKTYPKVEVSYTSFKIVADPEAPFLWDM
ITFVISQLPYLMDSGLPSRVAGVSGQNLILNASEPNMAEKIFKPINDTLHSRWPGKVLLHLETQHYPTFLAWFEK
NYDASSGGYSRYLVSRLLDKQSLTGNETALQDALRAANEPNGLLAFFTVAGKGVQDAKPRGGDAVHPAWRQAYVH
SVATAEFPPFNKTAERQAIAILDRSFQPLRDLTPRSGAYMNEALPFERDWQHTFWGSNYERLLAIKKRVDPDDVL
CRVGSLFPALRHISHITQPHSLTPISDSIPSTHHQFTTKHQHTIFPVQQPAHEALHCQAPATATMSAAEATFLSL
RPVPIDDKEPKNLAEFISRVNAQPGGFRHVTESALREAMETNGDVSVEDVVMVDAVEEEDAAVPSKDAASARLEV
LKGVDIAGNTAMLILDSLSLLLSKQSPTSASVTLSQQLRDMVGIGTLSVDRLDEPTAREERVKEGEQVATGWTLM
EINKTRDAAVSAAALLDKEVAIESRYWDDVMAVKKAGWSMCRVPNERHTLGVRFGFSETSAEFKNNGLAPMRRGE
DGSVELDVGRLGGVSECLVVSYVRNDRVVGRSRPHRRQRNANSLESRVLEARNTIFSQELWHELIKEARTLAAYD
VRLQGSKLRCRVDDETALIMELLELGSCPAPDDSLPHNGMAEAVSLGLHMLLSYAHRHNELMRTRPMPPHMSRSR
PTNQTYALLRPVIARLASDASIEACTRLVGSLSRSLTKAGLSSSFTLRPSSSPTTDTCSSTSNHASPSQTLIRNM
LQPRDLAIDFTILPDTSLSIRLRTFLFPVTSSHFNVSLPPDSPSAPRAPPYQDGYPDVRALADYLDTAVSRCLTR
HFLSRLLTSDADGTGRRWTESIVGTSIRDPDSDRWTLRFSTVRNDADPIAVAALVLVSSVVGPDGDPPRRSTWKW
SSGENPDDESRPMADVVAEVARMSPS*
Coding >Ophcf2|00778
ATGTGGGATCAGTTTACAAACTATAGCTGTCTGCCTGACGCCAACGCCCCCTGCACCGCTCGGGGGTACCCCCCG
TACGTCATCAATGCATCTACCGCAGGCCACGTCAAGACTGGCATCGACTTTGCCAGAAACCACAACATCAGGCTC
GTCGTCAAGAACAGCGGGCACGACTTCATCGGCCGATCTGTTGCTCCTGGAGCACTTTCTATCTGGGCTCATAAC
CTGAACAGCATAAAGTTCAAACCGGACGAGCTCCAGCTCGATGGCTCCAATCGAATCATCAAGACCAACTCCTTG
ACGGTCGGCGGCGGAGTTCAAATGTTCGATGCCTACAAGGCGGCCGATCAGCATGGACAAACCATTACCGGCGGC
GGAGGAAAGTCGGTTTCCTTTGGCGGCTACGTCTCTGGCGGCGGGCATTCGTTCGTCGCGCCATATCTTGGCTTG
GCTGCCGATAACATTTTGCAAATGGAGGTTGTTACTCCTGCTGGGGATATCATCGCCGTCAACGAGGATCGTTAC
CCAGACCTCTTCTGGGCCTTGAGAGGCGGGGGAGGCTCCACCTTTGGCGTCATCACAAGCCTGACCATCAAGACC
TACCCCAAGGTAGAAGTCAGCTATACAAGCTTCAAGATCGTCGCCGACCCTGAGGCTCCTTTTCTGTGGGATATG
ATAACCTTTGTCATCTCACAGTTGCCCTATCTTATGGACTCTGGCTTGCCTAGCAGGGTGGCAGGAGTATCGGGT
CAGAACCTGATTCTGAACGCAAGCGAGCCCAACATGGCGGAGAAGATCTTCAAGCCTATCAACGATACCCTGCAC
TCGAGATGGCCCGGAAAGGTTCTGCTGCATCTAGAAACACAGCACTATCCAACCTTCTTGGCCTGGTTCGAGAAG
AACTATGATGCCAGCAGTGGCGGCTACTCTCGCTACCTCGTGTCACGACTATTGGACAAGCAGTCACTCACGGGC
AACGAAACGGCGCTACAGGATGCACTGAGAGCAGCTAACGAGCCCAACGGCCTCTTGGCTTTCTTCACAGTTGCT
GGGAAGGGAGTTCAAGATGCGAAGCCGCGAGGAGGAGACGCTGTTCATCCAGCCTGGCGCCAGGCTTATGTTCAC
TCTGTTGCCACGGCTGAGTTTCCGCCCTTCAACAAGACGGCCGAGAGGCAGGCGATTGCGATACTTGACCGATCT
TTCCAGCCGTTGCGCGATCTGACACCAAGATCGGGAGCTTACATGAACGAGGCGCTCCCATTCGAAAGAGACTGG
CAGCATACCTTCTGGGGAAGCAACTACGAAAGACTGCTGGCGATTAAGAAACGTGTCGATCCAGATGATGTGTTG
TGTCGCGTCGGCTCCCTCTTTCCAGCCCTACGCCACATCAGCCACATCACACAGCCACACAGCCTCACGCCCATC
TCAGACTCCATCCCATCAACCCATCACCAGTTCACCACGAAGCATCAGCACACCATCTTCCCCGTTCAACAGCCC
GCGCATGAAGCTCTCCACTGCCAGGCTCCAGCCACCGCCACCATGTCGGCCGCAGAAGCCACCTTCCTCTCGCTG
AGGCCGGTGCCCATCGATGACAAGGAGCCCAAGAACCTGGCGGAATTCATCTCCCGCGTCAACGCTCAGCCTGGC
GGTTTCCGCCATGTCACCGAGTCAGCTCTTCGAGAAGCCATGGAGACGAATGGAGACGTTTCTGTCGAAGATGTC
GTCATGGTGGATGCCGTTGAGGAGGAAGATGCTGCTGTCCCGTCGAAAGATGCCGCTTCAGCTCGTCTGGAAGTA
CTCAAGGGCGTAGACATCGCCGGAAACACAGCCATGCTCATCCTCGACTCTCTCTCTCTCCTCCTCTCGAAACAA
AGCCCAACCTCAGCCAGCGTGACGCTCTCTCAACAGCTCCGCGACATGGTAGGCATCGGCACCCTCAGCGTCGAC
CGCCTCGACGAACCGACAGCCCGCGAAGAGCGCGTCAAAGAGGGAGAGCAGGTGGCGACGGGCTGGACCCTGATG
GAAATCAACAAGACGCGTGACGCCGCCGTCTCAGCCGCCGCCCTGCTGGACAAGGAGGTGGCCATCGAGAGCAGA
TACTGGGACGACGTCATGGCGGTTAAGAAGGCCGGCTGGTCCATGTGTCGCGTCCCGAACGAGAGACACACTCTC
GGCGTCCGCTTCGGCTTCTCCGAGACGTCGGCCGAGTTTAAGAATAACGGGCTGGCGCCGATGCGAAGGGGTGAA
GACGGCTCCGTTGAGCTCGACGTCGGTCGTCTGGGTGGCGTATCCGAGTGTCTCGTCGTCAGCTACGTCCGCAAC
GACCGAGTCGTCGGCCGCTCACGACCTCACCGCCGTCAACGAAACGCAAACTCTCTCGAGTCGCGCGTCCTCGAA
GCCCGCAACACAATCTTCTCACAGGAGCTTTGGCACGAGCTCATCAAGGAGGCCCGCACGCTGGCTGCCTACGAC
GTCCGTCTCCAGGGATCCAAGCTCCGGTGCCGTGTCGACGACGAGACGGCCCTGATCATGGAGCTCCTCGAGCTC
GGCTCCTGTCCGGCCCCGGACGACTCCCTACCGCACAACGGCATGGCCGAAGCCGTCTCGCTCGGTCTTCACATG
TTACTCTCCTACGCCCATCGCCACAACGAGCTGATGCGCACCAGGCCCATGCCACCACACATGTCCCGCTCGCGA
CCGACGAACCAGACCTACGCCCTCCTCCGCCCCGTCATCGCCCGTCTGGCCTCGGACGCCAGCATCGAGGCCTGC
ACCCGCCTCGTAGGCAGCCTCTCCCGATCACTGACAAAGGCAGGCCTCTCCTCGTCCTTTACCCTCCGACCGTCC
TCCTCTCCAACAACCGATACTTGCTCCTCCACTTCGAACCACGCATCGCCTTCGCAGACGCTCATCCGCAACATG
CTCCAGCCACGCGACCTGGCCATCGACTTCACCATCCTCCCAGACACCTCCCTCTCCATCCGCCTCCGCACCTTT
CTCTTCCCCGTCACGTCAAGCCACTTCAACGTCAGCCTCCCGCCCGACTCCCCCTCCGCCCCTCGAGCGCCCCCC
TACCAAGACGGATACCCCGACGTGCGCGCCCTGGCCGACTACCTCGACACCGCCGTCTCCCGCTGCCTAACGCGC
CACTTCCTCTCCCGCCTCCTGACCTCGGACGCCGACGGCACCGGCCGCCGCTGGACCGAGAGCATCGTCGGCACC
TCGATCCGCGATCCGGACTCGGACCGCTGGACCCTCCGCTTCTCCACCGTCCGCAACGACGCCGATCCCATAGCC
GTCGCCGCCCTCGTCCTCGTCAGCTCCGTCGTCGGTCCGGACGGCGATCCTCCCCGTCGCTCCACCTGGAAGTGG
TCCTCCGGGGAGAATCCCGACGACGAATCCCGTCCCATGGCCGACGTCGTCGCCGAGGTCGCCCGCATGTCGCCT
TCGTAG
Transcript >Ophcf2|00778
ATGTGGGATCAGTTTACAAACTATAGCTGTCTGCCTGACGCCAACGCCCCCTGCACCGCTCGGGGGTACCCCCCG
TACGTCATCAATGCATCTACCGCAGGCCACGTCAAGACTGGCATCGACTTTGCCAGAAACCACAACATCAGGCTC
GTCGTCAAGAACAGCGGGCACGACTTCATCGGCCGATCTGTTGCTCCTGGAGCACTTTCTATCTGGGCTCATAAC
CTGAACAGCATAAAGTTCAAACCGGACGAGCTCCAGCTCGATGGCTCCAATCGAATCATCAAGACCAACTCCTTG
ACGGTCGGCGGCGGAGTTCAAATGTTCGATGCCTACAAGGCGGCCGATCAGCATGGACAAACCATTACCGGCGGC
GGAGGAAAGTCGGTTTCCTTTGGCGGCTACGTCTCTGGCGGCGGGCATTCGTTCGTCGCGCCATATCTTGGCTTG
GCTGCCGATAACATTTTGCAAATGGAGGTTGTTACTCCTGCTGGGGATATCATCGCCGTCAACGAGGATCGTTAC
CCAGACCTCTTCTGGGCCTTGAGAGGCGGGGGAGGCTCCACCTTTGGCGTCATCACAAGCCTGACCATCAAGACC
TACCCCAAGGTAGAAGTCAGCTATACAAGCTTCAAGATCGTCGCCGACCCTGAGGCTCCTTTTCTGTGGGATATG
ATAACCTTTGTCATCTCACAGTTGCCCTATCTTATGGACTCTGGCTTGCCTAGCAGGGTGGCAGGAGTATCGGGT
CAGAACCTGATTCTGAACGCAAGCGAGCCCAACATGGCGGAGAAGATCTTCAAGCCTATCAACGATACCCTGCAC
TCGAGATGGCCCGGAAAGGTTCTGCTGCATCTAGAAACACAGCACTATCCAACCTTCTTGGCCTGGTTCGAGAAG
AACTATGATGCCAGCAGTGGCGGCTACTCTCGCTACCTCGTGTCACGACTATTGGACAAGCAGTCACTCACGGGC
AACGAAACGGCGCTACAGGATGCACTGAGAGCAGCTAACGAGCCCAACGGCCTCTTGGCTTTCTTCACAGTTGCT
GGGAAGGGAGTTCAAGATGCGAAGCCGCGAGGAGGAGACGCTGTTCATCCAGCCTGGCGCCAGGCTTATGTTCAC
TCTGTTGCCACGGCTGAGTTTCCGCCCTTCAACAAGACGGCCGAGAGGCAGGCGATTGCGATACTTGACCGATCT
TTCCAGCCGTTGCGCGATCTGACACCAAGATCGGGAGCTTACATGAACGAGGCGCTCCCATTCGAAAGAGACTGG
CAGCATACCTTCTGGGGAAGCAACTACGAAAGACTGCTGGCGATTAAGAAACGTGTCGATCCAGATGATGTGTTG
TGTCGCGTCGGCTCCCTCTTTCCAGCCCTACGCCACATCAGCCACATCACACAGCCACACAGCCTCACGCCCATC
TCAGACTCCATCCCATCAACCCATCACCAGTTCACCACGAAGCATCAGCACACCATCTTCCCCGTTCAACAGCCC
GCGCATGAAGCTCTCCACTGCCAGGCTCCAGCCACCGCCACCATGTCGGCCGCAGAAGCCACCTTCCTCTCGCTG
AGGCCGGTGCCCATCGATGACAAGGAGCCCAAGAACCTGGCGGAATTCATCTCCCGCGTCAACGCTCAGCCTGGC
GGTTTCCGCCATGTCACCGAGTCAGCTCTTCGAGAAGCCATGGAGACGAATGGAGACGTTTCTGTCGAAGATGTC
GTCATGGTGGATGCCGTTGAGGAGGAAGATGCTGCTGTCCCGTCGAAAGATGCCGCTTCAGCTCGTCTGGAAGTA
CTCAAGGGCGTAGACATCGCCGGAAACACAGCCATGCTCATCCTCGACTCTCTCTCTCTCCTCCTCTCGAAACAA
AGCCCAACCTCAGCCAGCGTGACGCTCTCTCAACAGCTCCGCGACATGGTAGGCATCGGCACCCTCAGCGTCGAC
CGCCTCGACGAACCGACAGCCCGCGAAGAGCGCGTCAAAGAGGGAGAGCAGGTGGCGACGGGCTGGACCCTGATG
GAAATCAACAAGACGCGTGACGCCGCCGTCTCAGCCGCCGCCCTGCTGGACAAGGAGGTGGCCATCGAGAGCAGA
TACTGGGACGACGTCATGGCGGTTAAGAAGGCCGGCTGGTCCATGTGTCGCGTCCCGAACGAGAGACACACTCTC
GGCGTCCGCTTCGGCTTCTCCGAGACGTCGGCCGAGTTTAAGAATAACGGGCTGGCGCCGATGCGAAGGGGTGAA
GACGGCTCCGTTGAGCTCGACGTCGGTCGTCTGGGTGGCGTATCCGAGTGTCTCGTCGTCAGCTACGTCCGCAAC
GACCGAGTCGTCGGCCGCTCACGACCTCACCGCCGTCAACGAAACGCAAACTCTCTCGAGTCGCGCGTCCTCGAA
GCCCGCAACACAATCTTCTCACAGGAGCTTTGGCACGAGCTCATCAAGGAGGCCCGCACGCTGGCTGCCTACGAC
GTCCGTCTCCAGGGATCCAAGCTCCGGTGCCGTGTCGACGACGAGACGGCCCTGATCATGGAGCTCCTCGAGCTC
GGCTCCTGTCCGGCCCCGGACGACTCCCTACCGCACAACGGCATGGCCGAAGCCGTCTCGCTCGGTCTTCACATG
TTACTCTCCTACGCCCATCGCCACAACGAGCTGATGCGCACCAGGCCCATGCCACCACACATGTCCCGCTCGCGA
CCGACGAACCAGACCTACGCCCTCCTCCGCCCCGTCATCGCCCGTCTGGCCTCGGACGCCAGCATCGAGGCCTGC
ACCCGCCTCGTAGGCAGCCTCTCCCGATCACTGACAAAGGCAGGCCTCTCCTCGTCCTTTACCCTCCGACCGTCC
TCCTCTCCAACAACCGATACTTGCTCCTCCACTTCGAACCACGCATCGCCTTCGCAGACGCTCATCCGCAACATG
CTCCAGCCACGCGACCTGGCCATCGACTTCACCATCCTCCCAGACACCTCCCTCTCCATCCGCCTCCGCACCTTT
CTCTTCCCCGTCACGTCAAGCCACTTCAACGTCAGCCTCCCGCCCGACTCCCCCTCCGCCCCTCGAGCGCCCCCC
TACCAAGACGGATACCCCGACGTGCGCGCCCTGGCCGACTACCTCGACACCGCCGTCTCCCGCTGCCTAACGCGC
CACTTCCTCTCCCGCCTCCTGACCTCGGACGCCGACGGCACCGGCCGCCGCTGGACCGAGAGCATCGTCGGCACC
TCGATCCGCGATCCGGACTCGGACCGCTGGACCCTCCGCTTCTCCACCGTCCGCAACGACGCCGATCCCATAGCC
GTCGCCGCCCTCGTCCTCGTCAGCTCCGTCGTCGGTCCGGACGGCGATCCTCCCCGTCGCTCCACCTGGAAGTGG
TCCTCCGGGGAGAATCCCGACGACGAATCCCGTCCCATGGCCGACGTCGTCGCCGAGGTCGCCCGCATGTCGCCT
TCGTAG
Gene >Ophcf2|00778
ATGTGGGATCAGTTTACAAACTATAGCTGTCTGCCTGACGCCAACGCCCCCTGCACCGCTCGGGGGTACCCCCCG
TACGTCATCAATGCATCTACCGCAGGCCACGTCAAGACTGGCATCGACTTTGGTATGTCCGCAACTACGGAGTGA
CGGAGAAGGCAATCTAAAGAGCCATTGATAGCCAGAAACCACAACATCAGGCTCGTCGTCAAGAACAGCGGGCAC
GACTTCATCGGCCGATCTGTTGCTCCTGGAGCACTTTCTATCTGGGCTCATAACCTGAACAGCATAAAGTTCAAA
CCGGACGAGCTCCAGCTCGATGGCTCCAATCGAATCATCAAGACCAACTCCTTGACGGTCGGCGGCGGAGTTCAA
ATGTTCGATGCCTACAAGGCGGCCGATCAGCATGGACAAACCATTACCGGCGGCGGAGGAAAGTCGGTTTCCTTT
GGCGGCTACGTCTCTGGCGGCGGGCATTCGTTCGTCGCGCCATATCTTGGCTTGGCTGCCGATAACATTTTGCAA
ATGGAGGTTGTTACTCCTGCTGGGGATATCATCGCCGTCAACGAGGATCGTTACCCAGACCTCTTCTGGGCCTTG
AGAGGCGTTCGTATGACCCAAGAACCCGAAAAGTACTCTGACTGACCGACTTCGTCTTCTCCAGGGGGGAGGCTC
CACCTTTGGCGTCATCACAAGCCTGACCATCAAGACCTACCCCAAGGTAGAAGTCAGCTATACAAGCTTCAAGAT
CGTCGCCGACCCTGAGGCTCCTTTTCTGTGGGATATGATAACCTTTGTCATCTCACAGTTGCCCTATCTTATGGA
CTCTGGGTTCGCCGGAAAAAACTTTGTGAATCACAGCATGCCAAATCCTGACCCATCGTCCAGCTTGCCTAGCAG
GGTGGCAGGAGTATCGGGTCAGAACCTGATTCTGAACGCAAGCGAGCCCAACATGGCGGAGAAGATCTTCAAGCC
TATCAACGATACCCTGCACTCGAGATGGCCCGGAAAGGTTCTGCTGCATCTAGAAACACAGCACTATCCAACCTT
CTTGGCCTGGTTCGAGAAGAACTATGATGCCAGCAGTGGCGGCTACTCTCGCTACCTCGTGTCACGACTATTGGA
CAAGCAGTCACTCACGGGCAACGAAACGGCGCTACAGGATGCACTGAGAGCAGCTAACGAGCCCAACGGCCTCTT
GGCTTTCTTCACAGTTGCTGGGAAGGGAGTTCAAGATGCGAAGCCGCGAGGAGGAGACGCTGTTCATCCAGCCTG
GCGCCAGGCTTATGTTCACTCTGTTGCCACGGCTGAGTTTCCGCCCTTCAACAAGACGGCCGAGAGGCAGGCGAT
TGCGATACTTGACCGATCTTTCCAGCCGTTGCGCGATCTGACACCAAGATCGGGAGCTTACATGAACGAGGTAGG
AAGGCTATCCCAGGCAGCAAAACCTCCATCTTTTGTTGAGGCAGAGCACGTAGACGACTGATGACTTTGACTCCG
AACAGGCGCTCCCATTCGAAAGAGACTGGCAGCATACCTTCTGGGGAAGCAACTACGAAAGACTGCTGGCGATTA
AGAAACGTGTCGATCCAGATGATGTGTTGTGGTGCTTCCCATGCGTCGGAAGTGAAGGGTGGATGCAGCGCTCAG
ACGGCGCTCTTTGCCGGAGACAATGAGCAGATGGACGAGGAAAGAGGGGAAACGCGAGGATTCGTGGACATCTTC
ATACATGAGTATCTTATTCATAGATTTAGAAGGCGCTCATACAAGCCACTTTCTGGGCTACTCTATGGCAACATG
AGTGTATCGTAAGAAATATATTGGGGTGTGTCGTCGGCAGCTTGAAAGCTCACAAGCACGTGACAGTCGCGTCGG
CTCCCTCTTTCCAGCCCTACGCCACATCAGCCACATCACACAGCCACACAGCCTCACGCCCATCTCAGACTCCAT
CCCATCAACCCATCACCAGTTCACCACGAAGCATCAGCACACCATCTTCCCCGTTCAACAGCCCGCGCATGAAGC
TCTCCACTGCCAGGCTCCAGCCACCGCCACCATGTCGGCCGCAGAAGCCACCTTCCTCTCGCTGAGGCCGGTGCC
CATCGATGACAAGGAGCCCAAGAACCTGGCGGAATTCATCTCCCGCGTCAACGCTCAGCCTGGCGGTTTCCGCCA
TGTCACCGAGTCAGCTCTTCGAGAAGCCATGGAGACGAATGGAGACGTTTCTGTCGAAGATGTCGTCATGGTGGA
TGCCGTTGAGGAGGAAGATGCTGCTGTCCCGTCGAAAGATGCCGCTTCAGCTCGTCTGGAAGTACTCAAGGGCGT
AGAGTACGTTTTCATCCCCCCCCCCCCATCACCCTCAGCAACAACTAAATCACAGCCCCTCAGCATCGCCGGAAA
CACAGCCATGCTCATCCTCGACTCTCTCTCTCTCCTCCTCTCGAAACAAAGCCCAACCTCAGCCAGCGTGACGCT
CTCTCAACAGCTCCGCGACATGGTAGGCATCGGCACCCTCAGCGTCGACCGCCTCGACGAACCGACAGCCCGCGA
AGAGCGCGTCAAAGAGGGAGAGCAGGTGGCGACGGGCTGGACCCTGATGGAAATCAACAAGACGCGTGACGCCGC
CGTCTCAGCCGCCGCCCTGCTGGACAAGGAGGTGGCCATCGAGAGCAGATACTGGGACGACGTCATGGCGGTTAA
GAAGGCCGGCTGGTCCATGTGTCGCGTCCCGAACGAGAGACACACTCTCGGCGTCCGCTTCGGCTTCTCCGAGAC
GTCGGCCGAGTTTAAGAATAACGGGCTGGCGCCGATGCGAAGGGGTGAAGACGGCTCCGTTGAGCTCGACGTCGG
TCGTCTGGGTGGCGTATCCGAGTGTCTCGTCGTCAGCTACGTCCGCAACGACCGAGTCGTCGGCCGCTCACGACC
TCACCGCCGTCAACGAAACGCAAACTCTCTCGAGTCGCGCGTCCTCGAAGCCCGCAACACAATCTTCTCACAGGA
GCTTTGGCACGAGCTCATCAAGGAGGCCCGCACGCTGGCTGCCTACGACGTCCGTCTCCAGGGATCCAAGCTCCG
GTGCCGTGTCGACGACGAGACGGCCCTGATCATGGAGCTCCTCGAGCTCGGCTCCTGTCCGGCCCCGGACGACTC
CCTACCGCACAACGGCATGGCCGAAGCCGTCTCGCTCGGTCTTCACATGTTACTCTCCTACGCCCATCGCCACAA
CGAGCTGATGCGCACCAGGCCCATGCCACCACACATGTCCCGCTCGCGACCGACGAACCAGACCTACGCCCTCCT
CCGCCCCGTCATCGCCCGTCTGGCCTCGGACGCCAGCATCGAGGCCTGCACCCGCCTCGTAGGCAGCCTCTCCCG
ATCACTGACAAAGGCAGGCCTCTCCTCGTCCTTTACCCTCCGACCGTCCTCCTCTCCAACAACCGATACTTGCTC
CTCCACTTCGAACCACGCATCGCCTTCGCAGACGCTCATCCGCAACATGCTCCAGCCACGCGACCTGGCCATCGA
CTTCACCATCCTCCCAGACACCTCCCTCTCCATCCGCCTCCGCACCTTTCTCTTCCCCGTCACGTCAAGCCACTT
CAACGTCAGCCTCCCGCCCGACTCCCCCTCCGCCCCTCGAGCGCCCCCCTACCAAGACGGATACCCCGACGTGCG
CGCCCTGGCCGACTACCTCGACACCGCCGTCTCCCGCTGCCTAACGCGCCACTTCCTCTCCCGCCTCCTGACCTC
GGACGCCGACGGCACCGGCCGCCGCTGGACCGAGAGCATCGTCGGCACCTCGATCCGCGATCCGGACTCGGACCG
CTGGACCCTCCGCTTCTCCACCGTCCGCAACGACGCCGATCCCATAGCCGTCGCCGCCCTCGTCCTCGTCAGCTC
CGTCGTCGGTCCGGACGGCGATCCTCCCCGTCGCTCCACCTGGAAGTGGTCCTCCGGGGAGAATCCCGACGACGA
ATCCCGTCCCATGGCCGACGTCGTCGCCGAGGTCGCCCGCATGTCGCCTTCGTAG

© 2023 - Robin Ohm - Utrecht University - The Netherlands

Built with Python Django and Wagtail