Fungal Genomics

at Utrecht University

General Properties

Protein IDOphcf2|00777
Gene name
Locationscaffold_01:2938344..2945415
Strand+
Gene length (bp)7071
Transcript length (bp)5670
Coding sequence length (bp)5670
Protein length (aa) 1890

Your browser does not support drawing a protein figure.

PFAM Domains

PFAM Domain ID Short name Long name E-value Start End
PF01663 Phosphodiest Type I phosphodiesterase / nucleotide pyrophosphatase 3.6E-96 234 573
PF00176 SNF2-rel_dom SNF2-related domain 1.6E-66 1179 1485
PF00271 Helicase_C Helicase conserved C-terminal domain 1.9E-14 1717 1830
PF13923 zf-C3HC4_2 Zinc finger, C3HC4 type (RING finger) 1.1E-07 1522 1554
PF13445 zf-RING_UBOX RING-type zinc-finger 7.0E-07 1523 1572
PF00097 zf-C3HC4 Zinc finger, C3HC4 type (RING finger) 5.7E-07 1523 1574
PF13920 zf-C3HC4_3 Zinc finger, C3HC4 type (RING finger) 6.1E-07 1520 1579
PF04851 ResIII Type III restriction enzyme, res subunit 2.7E-05 1163 1348

GO

GO Term Description Terminal node
GO:0005524 ATP binding Yes
GO:0016787 hydrolase activity Yes
GO:0140658 ATP-dependent chromatin remodeler activity Yes
GO:0046872 metal ion binding Yes
GO:0003677 DNA binding Yes
GO:0035639 purine ribonucleoside triphosphate binding No
GO:0097159 organic cyclic compound binding No
GO:0003676 nucleic acid binding No
GO:0043168 anion binding No
GO:1901363 heterocyclic compound binding No
GO:0043169 cation binding No
GO:0005488 binding No
GO:0032559 adenyl ribonucleotide binding No
GO:1901265 nucleoside phosphate binding No
GO:0003824 catalytic activity No
GO:0140097 catalytic activity, acting on DNA No
GO:0140657 ATP-dependent activity No
GO:0043167 ion binding No
GO:0097367 carbohydrate derivative binding No
GO:0030554 adenyl nucleotide binding No
GO:0003674 molecular_function No
GO:0032553 ribonucleotide binding No
GO:0017076 purine nucleotide binding No
GO:0140640 catalytic activity, acting on a nucleic acid No
GO:0032555 purine ribonucleotide binding No
GO:0000166 nucleotide binding No
GO:0008094 ATP-dependent activity, acting on DNA No
GO:0036094 small molecule binding No

SignalP

[Help with interpreting these statistics]
SignalP signal predicted Location
(based on Ymax)
D score
(significance: > 0.45)
No 1 - 12 0.45

Transmembrane Domains

Domain # Start End Length
1 188 207 19

Transcription Factor Class

(None)

Expression data

Analysis 1: Expression analysis during behavioral modification. Published in: Will et al., G3, 2020

Click here for more information

Sequences

Type of sequenceSequence
Locus Download genbank file of locus
The gene with 5 kb flanks (if sufficient flanking sequence is available). For use in cloning design programs. NOTE: features (genes or exons) that are only partially contained within the sequence are completely excluded.
Protein >Ophcf2|00777
MARHRPGRKAPEGDGNSLLSPVAYDDDASSLHSRSDQDSDSDDDQLQQRARNSRELRAHDRIVLMEEEEMDRLVT
SSRQEQKRVSSLNVPNPLRIFGRSPSHSSLPTEDADVISEKQKARRSRRRQRRQKMLRNARQGEDGELMYEMEEG
GMHSSGDSTPRRDSEEIDRHRLGLANAKAKRGRGCRRYIFPHLLIIIGFAILVLFAWKLSKGHSQPGKIQPLVSN
GSALFAPTTIILSLDGFRADFLQRGLTPTLNAFMAEGVSPPYMRPSFPSVTFPNHYTLATGLYPESHGVVGNTFW
DPNLLAEFYYTDPARSLDPKWWGGEPFWVTAELQGIRTAVHMWPGSEAHILRVEPSLMDKFNGKEKLPKKADRIL
EFLDMPGKEDASVNVKLTRPQLIAAYVPNVDADGHNYGPNSTETRSAIQEVDQMLDRLFSGLEQRNLTGIVNVIV
VSDHGMATTDTSRLIQLEDLVDMSLIEHTDGWPLYGLRPKNDGDLEAIHKQVKENTKSNPNVDVYLRDVDMPERY
HFSNNPRIAPLWIVPKTGWAIVKMDEFDVEKGKKEGIVYHPRGLHGYDHEHPLMRAIFIARGPAFPHPANSRLEP
FQNIEVYNILADSIGMDPKPNNGTLRLPLKPVGSHDEHETEAEPADPPPPATSEVPQRPTLVQGPVQPDESTAPK
RPTLPKKPTGAAVTGTEETEGSSAEQDAEENEESKSGSIKDRIKGALDWVAHRVRHWWQKPMAEHLDRNALTEEL
TIQRVILESLQDEQRPDAEQEREEARREIAHIRHLLEQERAEDAPPEASPLPDEPRGLADSAIAADGRSLQASPA
ATGTPIVRRHGSAAFSTPSRRVMNNDIWNSPAGSPLSSRKRGRQSPGPVGVASPAKSRRSTPRHEPGHSFQSSGS
SAVDVIDLTGDDVDLNAACVREQIKQEKRSKQEMRDRNIAMEMDQSSQLSELPLPAPTSGQGHTNAFSKIMATQK
SNAQRPMDDWDWPTQGSSSSSSNASLPPIMPGTWVDDDGDTKELIPGSHAYAAREAFGDSLRNASLPTLPQSHQS
LPSFSSVSTGLYVPSLGSRHPPHRLFGGVPLPPVPGSTGLHDVLNRTSGFDYSSQVDADGNPFSERLSSFLQHAY
HDTRFTSKELDDLLQNIRPDMDLPEGDRDGTPAGLKDKLYRHQELALTWMKNMEQGTNKGGILADDMGLGKTIST
LALILARPPATGLPKTTLVVAPVALVSQWREEIVKKTKLSHRLSVFVYHNKKATVDELMKYDVVITTYGTVAQEY
GRYDKFCTENGTRNVDMNDRTTATKFSLLHPGRAKFYRVVLDEAQCIKNKKTRTAKACQWIQATHRWCLTGTPMM
NNVGELYSLVHFLRIRPYCDWDHFRDDFGTLFGGRKGESKKIAMSKLRALLKAIMLRRKKDSQLDGKPILNLPAK
TEKVVHATLSSDERGFYKQLEEKSQVQFSKYLRDGTVGKNYSNILVLLLRMRQACCHPHLNVDVDEVNTGSGEDV
IEGVKNLSKSVVARIKAREEFECPICFDVVQSPTFFVPCGHDSCRDCLARLLDEATTQNLHAGNESDKAKCPQCR
GEFQANKCFSYETFRSVHMPETVAGNDDDGPEADENDDDDDDDDDDDDDFSDSWTDREDDADAHGNLRNFVVPDG
SVDDFDSSSTAAVTWEKARHKARKGKRKQTEVKPTMLRSLRKEALKNRDAYKRYMRYLRKTWMPSAKVTECIKLL
KQVQEAGEKAIVFSQWTMMLDLLQVAMWRESLRKPERYDGSMSGDARAAAARSFSNDSRVRVMLVSLRAGNAGLN
LTAASTVIIMDPFWNPYIEMQAIDRAHRIGQQREVSVYRILAEATVEDRIIQLQKRKKDLVEAALDESESMKIGR
LNVNELKFLFNTRD*
Coding >Ophcf2|00777
ATGGCTCGCCACAGACCTGGCCGCAAGGCTCCTGAAGGCGATGGAAACTCGCTGCTTTCTCCAGTTGCCTACGAT
GATGACGCCTCTTCTCTTCACAGTCGGAGCGATCAGGACAGCGACAGTGACGATGACCAGCTTCAGCAGCGCGCC
CGCAACAGCCGCGAGCTGCGTGCCCACGACCGCATCGTCCTGATGGAGGAAGAGGAGATGGATCGTTTGGTCACC
AGCTCACGGCAGGAACAGAAGCGAGTCTCGAGCCTCAACGTACCAAACCCTCTGCGCATCTTTGGCCGCTCCCCC
AGCCACTCGAGTCTACCGACCGAAGACGCCGATGTCATTTCGGAGAAGCAAAAGGCGAGGCGGTCCCGACGCAGG
CAGAGGCGCCAGAAGATGCTTCGAAATGCCCGCCAAGGCGAAGACGGCGAGCTCATGTACGAAATGGAGGAGGGA
GGCATGCACTCATCAGGCGACAGTACGCCTCGCCGTGACAGCGAAGAAATCGACCGACATCGCCTCGGCCTGGCC
AACGCAAAGGCCAAGCGCGGACGTGGTTGTCGTCGCTACATCTTCCCCCATCTACTCATCATCATTGGCTTCGCA
ATCCTCGTTCTCTTCGCCTGGAAGCTGTCCAAGGGTCACTCGCAGCCCGGCAAGATACAGCCCTTGGTCAGCAAC
GGAAGCGCCCTGTTTGCGCCGACGACCATCATACTCAGCCTCGACGGGTTCCGAGCCGATTTCTTGCAGCGAGGT
CTGACGCCGACACTAAACGCCTTCATGGCCGAGGGCGTCTCTCCCCCGTATATGCGCCCGTCTTTCCCGTCCGTC
ACCTTTCCGAACCATTACACCCTGGCAACGGGGCTGTATCCGGAGAGCCACGGCGTTGTGGGCAACACGTTCTGG
GACCCGAATCTACTCGCAGAGTTCTACTACACAGATCCAGCCCGGAGCCTTGACCCCAAGTGGTGGGGTGGGGAG
CCGTTCTGGGTCACGGCCGAGTTGCAGGGCATCCGCACGGCAGTCCACATGTGGCCCGGCAGTGAGGCTCACATT
CTCCGTGTCGAGCCCAGCTTGATGGACAAGTTCAATGGCAAGGAGAAGCTCCCTAAAAAGGCCGACAGGATCCTG
GAGTTCCTGGACATGCCGGGCAAGGAGGATGCGTCCGTCAACGTGAAGCTGACGCGGCCGCAGCTGATAGCGGCA
TATGTGCCAAACGTCGATGCTGACGGCCACAATTACGGCCCCAACAGCACCGAGACGCGGTCCGCCATCCAGGAG
GTTGACCAGATGCTGGACCGACTCTTCAGCGGCCTGGAGCAGCGTAACTTGACCGGCATCGTCAACGTCATCGTC
GTGTCTGATCATGGAATGGCCACGACGGACACATCGCGCCTAATCCAGCTGGAGGATTTGGTCGACATGTCCTTG
ATTGAGCATACCGACGGCTGGCCGCTGTACGGCCTCCGGCCAAAGAACGACGGCGACCTCGAGGCCATCCACAAG
CAGGTCAAGGAAAATACCAAGTCTAACCCCAACGTGGACGTCTACCTCCGCGACGTCGACATGCCTGAAAGATAC
CACTTCTCCAACAACCCGCGCATCGCTCCCCTCTGGATCGTGCCCAAGACGGGCTGGGCCATTGTCAAGATGGAC
GAGTTCGACGTCGAGAAGGGCAAGAAGGAGGGCATCGTCTACCATCCCCGGGGGCTGCACGGCTACGATCACGAA
CATCCGCTGATGCGGGCCATCTTCATCGCTCGGGGGCCGGCGTTTCCACACCCGGCCAACAGCCGACTAGAGCCT
TTCCAAAATATCGAGGTCTACAATATTTTGGCCGACTCTATCGGAATGGATCCGAAGCCCAACAACGGGACGCTC
CGCCTGCCGCTCAAGCCCGTCGGCAGTCATGACGAGCACGAGACGGAAGCCGAGCCTGCGGATCCCCCACCTCCG
GCGACATCCGAGGTGCCGCAACGGCCAACCCTCGTCCAAGGTCCGGTGCAGCCGGACGAGTCTACGGCGCCGAAA
CGGCCAACGCTGCCCAAGAAGCCCACAGGCGCGGCGGTGACGGGGACAGAGGAGACGGAAGGCAGCAGCGCCGAG
CAAGATGCGGAGGAGAACGAGGAGTCCAAGTCGGGCTCCATCAAGGACCGCATCAAGGGGGCGCTCGATTGGGTA
GCCCACCGAGTCAGGCACTGGTGGCAAAAGCCAATGGCGGAGCATCTCGATCGCAACGCCCTGACGGAGGAGCTG
ACGATCCAGCGAGTCATCCTCGAATCACTGCAGGACGAGCAAAGGCCCGATGCCGAGCAAGAACGAGAAGAAGCC
CGCAGGGAGATTGCCCATATACGACACCTTCTCGAACAGGAACGAGCTGAAGACGCTCCGCCCGAGGCCTCGCCG
CTGCCTGATGAGCCTCGTGGCTTGGCTGACTCTGCCATTGCGGCCGACGGTCGTTCTCTGCAAGCCTCGCCTGCC
GCCACAGGCACTCCTATCGTCCGACGCCACGGCTCGGCTGCCTTTTCCACGCCGTCTAGGAGGGTCATGAACAAC
GACATCTGGAACAGTCCGGCCGGCAGCCCGCTCTCCAGTCGCAAGCGAGGACGGCAATCGCCCGGTCCGGTGGGT
GTCGCTAGCCCGGCCAAGTCTCGCCGCTCCACTCCGCGACACGAGCCGGGCCACTCGTTCCAAAGTTCCGGCAGC
AGTGCAGTTGATGTGATTGACCTGACCGGAGACGACGTCGATCTCAATGCCGCCTGCGTCAGAGAGCAGATCAAG
CAGGAAAAGAGAAGCAAGCAAGAGATGAGGGACCGAAATATAGCCATGGAGATGGACCAGTCGTCCCAGCTCAGC
GAGTTGCCCCTTCCCGCTCCGACGTCGGGCCAAGGTCACACAAATGCCTTTTCCAAAATCATGGCCACGCAAAAG
TCCAACGCTCAACGACCCATGGATGACTGGGACTGGCCGACGCAAGGCTCTTCCTCGTCCTCAAGCAATGCTTCT
CTCCCGCCCATCATGCCCGGCACTTGGGTCGACGACGATGGCGACACGAAAGAGCTTATTCCCGGCTCGCACGCC
TATGCAGCGCGTGAGGCCTTTGGCGACTCGCTCCGGAATGCCTCTCTGCCGACACTTCCGCAGTCTCACCAGTCA
TTGCCGTCCTTTTCGAGCGTCTCTACCGGCCTCTACGTCCCGTCGCTGGGATCTAGGCACCCTCCTCACAGGCTT
TTCGGCGGCGTGCCTCTACCACCAGTCCCGGGCAGCACGGGCTTGCATGACGTACTCAACAGAACCAGCGGATTC
GATTACTCTTCTCAAGTGGACGCCGACGGTAACCCCTTTTCGGAGCGGCTGTCGAGCTTCCTGCAGCACGCCTAT
CATGACACGCGATTCACGTCGAAGGAACTAGACGACTTGCTCCAGAACATCCGCCCGGACATGGACTTACCGGAG
GGTGACCGGGACGGAACACCGGCGGGACTCAAGGATAAGCTCTACCGTCACCAGGAGCTCGCCTTGACTTGGATG
AAGAACATGGAGCAGGGGACCAACAAGGGGGGCATCCTTGCAGACGACATGGGCCTAGGCAAGACGATATCAACG
TTGGCCCTGATCCTGGCGAGACCTCCCGCCACCGGCCTGCCCAAGACGACGCTCGTCGTAGCCCCGGTGGCCCTG
GTCAGCCAGTGGCGGGAAGAAATCGTCAAGAAGACCAAACTCAGCCACCGTCTGTCCGTCTTCGTCTATCACAAC
AAGAAGGCTACCGTGGACGAGCTCATGAAGTACGACGTTGTCATCACGACCTACGGCACCGTTGCGCAGGAATAC
GGACGCTACGACAAGTTCTGCACGGAAAACGGGACGCGAAACGTTGACATGAACGATCGCACCACGGCAACCAAG
TTTTCGCTGCTGCACCCGGGCAGGGCAAAGTTCTACCGAGTCGTGCTGGATGAGGCGCAGTGCATCAAGAACAAG
AAGACTCGGACGGCCAAGGCTTGCCAGTGGATCCAGGCCACGCATCGATGGTGTCTCACCGGCACGCCCATGATG
AACAACGTGGGCGAGCTCTATTCGCTCGTGCACTTCCTGAGGATCAGGCCCTACTGCGACTGGGACCACTTTCGA
GATGACTTTGGTACTCTCTTCGGTGGACGCAAGGGTGAATCCAAGAAGATTGCCATGAGCAAGCTCAGGGCGCTC
CTCAAGGCAATCATGCTGCGCCGCAAGAAGGACTCGCAGCTGGACGGGAAACCCATCCTCAACCTACCGGCCAAG
ACGGAGAAGGTCGTTCACGCCACGCTTTCGAGCGACGAGAGGGGATTCTACAAGCAGCTCGAGGAGAAGTCGCAA
GTGCAGTTTAGCAAGTATCTGCGCGACGGCACGGTCGGCAAGAATTACTCCAACATCCTCGTGCTACTGCTCCGC
ATGCGACAAGCCTGCTGCCATCCGCATCTCAACGTCGACGTCGACGAAGTGAACACCGGGAGCGGCGAAGACGTC
ATCGAGGGCGTCAAGAACCTGAGCAAGAGCGTGGTGGCAAGGATCAAGGCCAGGGAAGAATTCGAGTGCCCGATT
TGCTTCGACGTGGTTCAGTCGCCCACCTTTTTCGTCCCCTGCGGCCACGACAGCTGCAGGGACTGTCTGGCGCGG
CTGCTCGACGAGGCGACGACGCAGAACCTTCACGCCGGCAACGAGAGCGACAAGGCCAAGTGCCCGCAGTGTCGC
GGCGAGTTCCAAGCCAACAAGTGTTTCTCTTACGAGACTTTCCGAAGCGTCCACATGCCCGAGACGGTTGCCGGG
AACGATGACGACGGACCAGAGGCTGACGAGAATGACGACGATGATGATGACGACGACGATGATGACGACGACTTT
TCGGACTCGTGGACGGATCGGGAAGACGATGCCGACGCGCACGGAAACCTGCGTAACTTTGTGGTCCCCGACGGT
AGCGTCGACGACTTTGACTCGAGCTCGACGGCGGCGGTGACATGGGAAAAGGCCCGTCACAAGGCGCGAAAGGGG
AAGCGGAAGCAGACAGAAGTCAAGCCGACGATGCTTCGCAGTCTGCGGAAGGAGGCGCTCAAGAACCGCGACGCC
TACAAGCGGTACATGCGTTACCTCCGCAAGACGTGGATGCCCTCGGCCAAGGTGACGGAGTGCATCAAGCTGCTC
AAGCAGGTGCAGGAAGCGGGCGAAAAGGCCATCGTCTTCTCCCAGTGGACGATGATGCTGGACCTGCTGCAGGTG
GCCATGTGGCGTGAGAGCCTCCGCAAGCCTGAGCGGTACGACGGCAGCATGTCAGGCGACGCGCGGGCGGCAGCG
GCCCGGAGCTTCAGCAACGACTCTCGCGTACGCGTCATGCTGGTGTCTCTGCGGGCGGGCAACGCTGGTCTGAAC
CTGACGGCCGCCAGCACCGTCATCATCATGGACCCCTTCTGGAACCCTTATATCGAGATGCAGGCCATTGACCGG
GCACACCGCATCGGCCAGCAGCGAGAGGTGAGCGTGTACCGCATCCTGGCAGAGGCGACGGTCGAGGACCGCATC
ATCCAGCTGCAGAAGCGCAAGAAGGATCTGGTTGAGGCTGCCCTGGACGAGTCGGAGAGTATGAAGATTGGGAGG
CTCAACGTCAACGAGCTCAAGTTTTTGTTTAACACGAGGGATTAG
Transcript >Ophcf2|00777
ATGGCTCGCCACAGACCTGGCCGCAAGGCTCCTGAAGGCGATGGAAACTCGCTGCTTTCTCCAGTTGCCTACGAT
GATGACGCCTCTTCTCTTCACAGTCGGAGCGATCAGGACAGCGACAGTGACGATGACCAGCTTCAGCAGCGCGCC
CGCAACAGCCGCGAGCTGCGTGCCCACGACCGCATCGTCCTGATGGAGGAAGAGGAGATGGATCGTTTGGTCACC
AGCTCACGGCAGGAACAGAAGCGAGTCTCGAGCCTCAACGTACCAAACCCTCTGCGCATCTTTGGCCGCTCCCCC
AGCCACTCGAGTCTACCGACCGAAGACGCCGATGTCATTTCGGAGAAGCAAAAGGCGAGGCGGTCCCGACGCAGG
CAGAGGCGCCAGAAGATGCTTCGAAATGCCCGCCAAGGCGAAGACGGCGAGCTCATGTACGAAATGGAGGAGGGA
GGCATGCACTCATCAGGCGACAGTACGCCTCGCCGTGACAGCGAAGAAATCGACCGACATCGCCTCGGCCTGGCC
AACGCAAAGGCCAAGCGCGGACGTGGTTGTCGTCGCTACATCTTCCCCCATCTACTCATCATCATTGGCTTCGCA
ATCCTCGTTCTCTTCGCCTGGAAGCTGTCCAAGGGTCACTCGCAGCCCGGCAAGATACAGCCCTTGGTCAGCAAC
GGAAGCGCCCTGTTTGCGCCGACGACCATCATACTCAGCCTCGACGGGTTCCGAGCCGATTTCTTGCAGCGAGGT
CTGACGCCGACACTAAACGCCTTCATGGCCGAGGGCGTCTCTCCCCCGTATATGCGCCCGTCTTTCCCGTCCGTC
ACCTTTCCGAACCATTACACCCTGGCAACGGGGCTGTATCCGGAGAGCCACGGCGTTGTGGGCAACACGTTCTGG
GACCCGAATCTACTCGCAGAGTTCTACTACACAGATCCAGCCCGGAGCCTTGACCCCAAGTGGTGGGGTGGGGAG
CCGTTCTGGGTCACGGCCGAGTTGCAGGGCATCCGCACGGCAGTCCACATGTGGCCCGGCAGTGAGGCTCACATT
CTCCGTGTCGAGCCCAGCTTGATGGACAAGTTCAATGGCAAGGAGAAGCTCCCTAAAAAGGCCGACAGGATCCTG
GAGTTCCTGGACATGCCGGGCAAGGAGGATGCGTCCGTCAACGTGAAGCTGACGCGGCCGCAGCTGATAGCGGCA
TATGTGCCAAACGTCGATGCTGACGGCCACAATTACGGCCCCAACAGCACCGAGACGCGGTCCGCCATCCAGGAG
GTTGACCAGATGCTGGACCGACTCTTCAGCGGCCTGGAGCAGCGTAACTTGACCGGCATCGTCAACGTCATCGTC
GTGTCTGATCATGGAATGGCCACGACGGACACATCGCGCCTAATCCAGCTGGAGGATTTGGTCGACATGTCCTTG
ATTGAGCATACCGACGGCTGGCCGCTGTACGGCCTCCGGCCAAAGAACGACGGCGACCTCGAGGCCATCCACAAG
CAGGTCAAGGAAAATACCAAGTCTAACCCCAACGTGGACGTCTACCTCCGCGACGTCGACATGCCTGAAAGATAC
CACTTCTCCAACAACCCGCGCATCGCTCCCCTCTGGATCGTGCCCAAGACGGGCTGGGCCATTGTCAAGATGGAC
GAGTTCGACGTCGAGAAGGGCAAGAAGGAGGGCATCGTCTACCATCCCCGGGGGCTGCACGGCTACGATCACGAA
CATCCGCTGATGCGGGCCATCTTCATCGCTCGGGGGCCGGCGTTTCCACACCCGGCCAACAGCCGACTAGAGCCT
TTCCAAAATATCGAGGTCTACAATATTTTGGCCGACTCTATCGGAATGGATCCGAAGCCCAACAACGGGACGCTC
CGCCTGCCGCTCAAGCCCGTCGGCAGTCATGACGAGCACGAGACGGAAGCCGAGCCTGCGGATCCCCCACCTCCG
GCGACATCCGAGGTGCCGCAACGGCCAACCCTCGTCCAAGGTCCGGTGCAGCCGGACGAGTCTACGGCGCCGAAA
CGGCCAACGCTGCCCAAGAAGCCCACAGGCGCGGCGGTGACGGGGACAGAGGAGACGGAAGGCAGCAGCGCCGAG
CAAGATGCGGAGGAGAACGAGGAGTCCAAGTCGGGCTCCATCAAGGACCGCATCAAGGGGGCGCTCGATTGGGTA
GCCCACCGAGTCAGGCACTGGTGGCAAAAGCCAATGGCGGAGCATCTCGATCGCAACGCCCTGACGGAGGAGCTG
ACGATCCAGCGAGTCATCCTCGAATCACTGCAGGACGAGCAAAGGCCCGATGCCGAGCAAGAACGAGAAGAAGCC
CGCAGGGAGATTGCCCATATACGACACCTTCTCGAACAGGAACGAGCTGAAGACGCTCCGCCCGAGGCCTCGCCG
CTGCCTGATGAGCCTCGTGGCTTGGCTGACTCTGCCATTGCGGCCGACGGTCGTTCTCTGCAAGCCTCGCCTGCC
GCCACAGGCACTCCTATCGTCCGACGCCACGGCTCGGCTGCCTTTTCCACGCCGTCTAGGAGGGTCATGAACAAC
GACATCTGGAACAGTCCGGCCGGCAGCCCGCTCTCCAGTCGCAAGCGAGGACGGCAATCGCCCGGTCCGGTGGGT
GTCGCTAGCCCGGCCAAGTCTCGCCGCTCCACTCCGCGACACGAGCCGGGCCACTCGTTCCAAAGTTCCGGCAGC
AGTGCAGTTGATGTGATTGACCTGACCGGAGACGACGTCGATCTCAATGCCGCCTGCGTCAGAGAGCAGATCAAG
CAGGAAAAGAGAAGCAAGCAAGAGATGAGGGACCGAAATATAGCCATGGAGATGGACCAGTCGTCCCAGCTCAGC
GAGTTGCCCCTTCCCGCTCCGACGTCGGGCCAAGGTCACACAAATGCCTTTTCCAAAATCATGGCCACGCAAAAG
TCCAACGCTCAACGACCCATGGATGACTGGGACTGGCCGACGCAAGGCTCTTCCTCGTCCTCAAGCAATGCTTCT
CTCCCGCCCATCATGCCCGGCACTTGGGTCGACGACGATGGCGACACGAAAGAGCTTATTCCCGGCTCGCACGCC
TATGCAGCGCGTGAGGCCTTTGGCGACTCGCTCCGGAATGCCTCTCTGCCGACACTTCCGCAGTCTCACCAGTCA
TTGCCGTCCTTTTCGAGCGTCTCTACCGGCCTCTACGTCCCGTCGCTGGGATCTAGGCACCCTCCTCACAGGCTT
TTCGGCGGCGTGCCTCTACCACCAGTCCCGGGCAGCACGGGCTTGCATGACGTACTCAACAGAACCAGCGGATTC
GATTACTCTTCTCAAGTGGACGCCGACGGTAACCCCTTTTCGGAGCGGCTGTCGAGCTTCCTGCAGCACGCCTAT
CATGACACGCGATTCACGTCGAAGGAACTAGACGACTTGCTCCAGAACATCCGCCCGGACATGGACTTACCGGAG
GGTGACCGGGACGGAACACCGGCGGGACTCAAGGATAAGCTCTACCGTCACCAGGAGCTCGCCTTGACTTGGATG
AAGAACATGGAGCAGGGGACCAACAAGGGGGGCATCCTTGCAGACGACATGGGCCTAGGCAAGACGATATCAACG
TTGGCCCTGATCCTGGCGAGACCTCCCGCCACCGGCCTGCCCAAGACGACGCTCGTCGTAGCCCCGGTGGCCCTG
GTCAGCCAGTGGCGGGAAGAAATCGTCAAGAAGACCAAACTCAGCCACCGTCTGTCCGTCTTCGTCTATCACAAC
AAGAAGGCTACCGTGGACGAGCTCATGAAGTACGACGTTGTCATCACGACCTACGGCACCGTTGCGCAGGAATAC
GGACGCTACGACAAGTTCTGCACGGAAAACGGGACGCGAAACGTTGACATGAACGATCGCACCACGGCAACCAAG
TTTTCGCTGCTGCACCCGGGCAGGGCAAAGTTCTACCGAGTCGTGCTGGATGAGGCGCAGTGCATCAAGAACAAG
AAGACTCGGACGGCCAAGGCTTGCCAGTGGATCCAGGCCACGCATCGATGGTGTCTCACCGGCACGCCCATGATG
AACAACGTGGGCGAGCTCTATTCGCTCGTGCACTTCCTGAGGATCAGGCCCTACTGCGACTGGGACCACTTTCGA
GATGACTTTGGTACTCTCTTCGGTGGACGCAAGGGTGAATCCAAGAAGATTGCCATGAGCAAGCTCAGGGCGCTC
CTCAAGGCAATCATGCTGCGCCGCAAGAAGGACTCGCAGCTGGACGGGAAACCCATCCTCAACCTACCGGCCAAG
ACGGAGAAGGTCGTTCACGCCACGCTTTCGAGCGACGAGAGGGGATTCTACAAGCAGCTCGAGGAGAAGTCGCAA
GTGCAGTTTAGCAAGTATCTGCGCGACGGCACGGTCGGCAAGAATTACTCCAACATCCTCGTGCTACTGCTCCGC
ATGCGACAAGCCTGCTGCCATCCGCATCTCAACGTCGACGTCGACGAAGTGAACACCGGGAGCGGCGAAGACGTC
ATCGAGGGCGTCAAGAACCTGAGCAAGAGCGTGGTGGCAAGGATCAAGGCCAGGGAAGAATTCGAGTGCCCGATT
TGCTTCGACGTGGTTCAGTCGCCCACCTTTTTCGTCCCCTGCGGCCACGACAGCTGCAGGGACTGTCTGGCGCGG
CTGCTCGACGAGGCGACGACGCAGAACCTTCACGCCGGCAACGAGAGCGACAAGGCCAAGTGCCCGCAGTGTCGC
GGCGAGTTCCAAGCCAACAAGTGTTTCTCTTACGAGACTTTCCGAAGCGTCCACATGCCCGAGACGGTTGCCGGG
AACGATGACGACGGACCAGAGGCTGACGAGAATGACGACGATGATGATGACGACGACGATGATGACGACGACTTT
TCGGACTCGTGGACGGATCGGGAAGACGATGCCGACGCGCACGGAAACCTGCGTAACTTTGTGGTCCCCGACGGT
AGCGTCGACGACTTTGACTCGAGCTCGACGGCGGCGGTGACATGGGAAAAGGCCCGTCACAAGGCGCGAAAGGGG
AAGCGGAAGCAGACAGAAGTCAAGCCGACGATGCTTCGCAGTCTGCGGAAGGAGGCGCTCAAGAACCGCGACGCC
TACAAGCGGTACATGCGTTACCTCCGCAAGACGTGGATGCCCTCGGCCAAGGTGACGGAGTGCATCAAGCTGCTC
AAGCAGGTGCAGGAAGCGGGCGAAAAGGCCATCGTCTTCTCCCAGTGGACGATGATGCTGGACCTGCTGCAGGTG
GCCATGTGGCGTGAGAGCCTCCGCAAGCCTGAGCGGTACGACGGCAGCATGTCAGGCGACGCGCGGGCGGCAGCG
GCCCGGAGCTTCAGCAACGACTCTCGCGTACGCGTCATGCTGGTGTCTCTGCGGGCGGGCAACGCTGGTCTGAAC
CTGACGGCCGCCAGCACCGTCATCATCATGGACCCCTTCTGGAACCCTTATATCGAGATGCAGGCCATTGACCGG
GCACACCGCATCGGCCAGCAGCGAGAGGTGAGCGTGTACCGCATCCTGGCAGAGGCGACGGTCGAGGACCGCATC
ATCCAGCTGCAGAAGCGCAAGAAGGATCTGGTTGAGGCTGCCCTGGACGAGTCGGAGAGTATGAAGATTGGGAGG
CTCAACGTCAACGAGCTCAAGTTTTTGTTTAACACGAGGGATTAG
Gene >Ophcf2|00777
ATGGCTCGCCACAGACCTGGCCGCAAGGCTCCTGAAGGCGATGGAAACTCGCTGCTTTCTCCAGTTGCCTACGAT
GATGACGCCTCTTCTCTTCACAGTCGGAGCGATCAGGACAGCGACAGTGACGATGACCAGCTTCAGCAGCGCGCC
CGCAACAGCCGCGAGCTGCGTGCCCACGACCGCATCGTCCTGATGGAGGAAGAGGAGATGGATCGTTTGGTCACC
AGCTCACGGCAGGAACAGAAGCGAGTCTCGAGCCTCAACGTACCAAACCCTCTGCGCATCTTTGGCCGCTCCCCC
AGCCACTCGAGTCTACCGACCGAAGACGCCGATGTCATTTCGGAGAAGCAAAAGGCGAGGCGGTCCCGACGCAGG
CAGAGGCGCCAGAAGATGCTTCGAAATGCCCGCCAAGGCGAAGACGGCGAGCTCATGTACGAAATGGAGGAGGGA
GGCATGCACTCATCAGGCGACAGTACGCCTCGCCGTGACAGCGAAGAAATCGACCGACATCGCCTCGGCCTGGCC
AACGCAAAGGCCAAGCGCGGACGTGGTTGTCGTCGCTACATCTTCCCCCATCTACTCATCATCATTGGCTTCGCA
ATCCTCGTTCTCTTCGCCTGGAAGCTGTCCAAGGGTCACTCGCAGCCCGGCAAGATACAGCCCTTGGTCAGCAAC
GGAAGCGCCCTGTTTGCGCCGACGACCATCATACTCAGCCTCGACGGGTTCCGAGCCGATTTCTTGCAGCGAGGT
CTGACGCCGACACTAAACGCCTTCATGGCCGAGGGCGTCTCTCCCCCGTATATGCGCCCGTCTTTCCCGTCCGTC
ACCTTTCCGAACCATTACACCCTGGCAACGGGGCTGTATCCGGAGAGCCACGGCGTTGTGGGCAACACGTTCTGG
GACCCGAATCTACTCGCAGAGTTCTACTACACAGATCCAGCCCGGAGCCTTGACCCCAAGTGGTGGGGTGGGGAG
CCGTTCTGGGTCACGGCCGAGTTGCAGGGCATCCGCACGGCAGTCCACATGTGGCCCGGCAGTGAGGCTCACATT
CTCCGTGTCGAGCCCAGCTTGATGGACAAGTTCAATGGCAAGGAGAAGCTCCCTAAAAAGGCCGACAGGATCCTG
GAGTTCCTGGACATGCCGGGCAAGGAGGATGCGTCCGTCAACGTGAAGCTGACGCGGCCGCAGCTGATAGCGGCA
TATGTGCCAAACGTCGATGCTGACGGCCACAATTACGGCCCCAACAGCACCGAGACGCGGTCCGCCATCCAGGAG
GTTGACCAGATGCTGGACCGACTCTTCAGCGGCCTGGAGCAGCGTAACTTGACCGGCATCGTCAACGTCATCGTC
GTGTCTGATCATGGAATGGCCACGACGGACACATCGCGCCTAATCCAGCTGGAGGATTTGGTCGACATGTCCTTG
ATTGAGCATACCGACGGCTGGCCGCTGTACGGCCTCCGGCCAAAGAACGACGGCGACCTCGAGGCCATCCACAAG
CAGGTCAAGGAAAATACCAAGTCTAACCCCAACGTGGACGTCTACCTCCGCGACGTCGACATGCCTGAAAGATAC
CACTTCTCCAACAACCCGCGCATCGCTCCCCTCTGGATCGTGCCCAAGACGGGCTGGGCCATTGTCAAGATGGAC
GAGTTCGACGTCGAGAAGGGCAAGAAGGAGGGCATCGTCTACCATCCCCGGGGGCTGCACGGCTACGATCACGAA
CATCCGCTGATGCGGGCCATCTTCATCGCTCGGGGGCCGGCGTTTCCACACCCGGCCAACAGCCGACTAGAGCCT
TTCCGTGAGTGAGCCGGTCCGGAACTGAACCGATGCATGGCTGACCCATTCATAGAAAATATCGAGGTCTACAAT
ATTTTGGCCGACTCTATCGGAATGGATCCGAAGCCCAACAACGGGACGCTCCGCCTGCCGCTCAAGCCCGTCGGC
AGTCATGACGAGCACGAGACGGAAGCCGAGCCTGCGGATCCCCCACCTCCGGCGACATCCGAGGTGCCGCAACGG
CCAACCCTCGTCCAAGGTCCGGTGCAGCCGGACGAGTCTACGGCGCCGAAACGGCCAACGCTGCCCAAGAAGCCC
ACAGGCGCGGCGGTGACGGGGACAGAGGAGACGGAAGGCAGCAGCGCCGAGCAAGATGCGGAGGAGAACGAGGAG
TCCAAGTCGGGCTCCATCAAGGACCGCATCAAGGGGGCGCTCGATTGGGTAGCCCACCGAGTCAGGCACTGGTGG
CAAAAGGTGAGGGGCTTTCACCGGAAAGGGAGCTGACACGCACGTGCGCGTATCCAATGAATTTTTTTTTTTCTT
GTTTTTGGTTTTGGTTCTGGCCGGGGCGTTTTTGTCTAGAGGCGTATCATGCCATGTGAACAATTAGTATTGGCT
ATTCTCTGCCCTAGATTTCATATTTTTGTTCCCTTTTTGGGCTGTCTTTGCGCGAAGGGAAGACAGAGTCTGTCA
GGCCAATTCTGACACGGAGAGATGACGGCTGGGAGCGTCGGAGATTTAAAAGCGGCGCGGCCAGACAGTAAAGAG
AGGAAATTGTTGGCTTGTTTTCTCTTTTCCAGTCGAGATGCGTGACGCGGTTGAGTCGTCGCTGCTATCTGACTA
AGCAGATCTAGACGCGCCTCTTGCCTTTTGCGGCAATCACTCAAATCTCGAGACATTACAGTGCGTCAGGTCCGG
AACGCGCACCGTACGCTTTCGAAATCAAACTATGGCTTTTTTTTTTCTTTCTTGGCGATGAAAGATTTGACCTCG
GTCAAGCACGCCGAGCGTTTGTGTCTTTCAATCGGTGATCCATTATCGCGAGAAGGTCTTGATCCATCTCGTGAC
GCGTCTTCATCCCCGGGCCCGACTCTTCGAACCGCTCTTCAGACGCTGTGCGAATCGTTTGGCTAAAGAGAGAAG
GGGAGGCGACAGACGAGGCTCGTATCGGCAGGGGAAAAGGATCGCCTGAGGAATACGGGAGAGACGAGACGAGAC
GAGAGAGAGATCAGAGCACAAGCCGTCTCCTCAATCAACCGCCTGTCATCCGACTTCTTTCCTCTTCTCGCGCAG
GCCATTCGTTCTTCGACTCGGCTTGCTGCTTTTTCTCGAGACGACAACCGACCCCGATTCTCCCCTTTACCGTGG
CTGGTGCAGCACCGAGCCGCCGCCTTCTCCGACCTGCTGCGAGCACGAATGCGTGCCTCCTGGTCGAGCCAATGG
CGGAGCATCTCGATCGCAACGCCCTGACGGAGGAGCTGACGATCCAGCGAGTCATCCTCGAATCACTGCAGGACG
AGCAAAGGCCCGATGCCGAGCAAGAACGAGAAGAAGCCCGCAGGGAGATTGCCCATATACGACACCTTCTCGAAC
AGGAACGAGCTGAAGACGCTCCGCCCGAGGCCTCGCCGCTGCCTGATGAGCCTCGTGGCTTGGCTGACTCTGCCA
TTGCGGCCGACGGTCGTTCTCTGCAAGCCTCGCCTGCCGGTAAGCCTCCCCCGTCCTGCGCCACCTTTCGCCCGG
TCTCTCTATACCTACCCATTTACCTGCTTGGCCCAAATCCTTGTATCTGTCCGCCCCCCCCCCCCCCCCCTTTAT
TACCCTTCGTCAGCTGCCTGCCACCTGGCCGACATGCGGCTTCGGAGCCGATCTTAATCATCCATCATCCTCCCA
TTCTCCCTGCTGACGGCACCTTTCTCCAGCCACAGGCACTCCTATCGTCCGACGCCACGGCTCGGCTGCCTTTTC
CACGCCGTCTAGGAGGGTCATGAACAACGACATCTGGAACAGTCCGGCCGGCAGCCCGCTCTCCAGTCGCAAGCG
AGGACGGCAATCGCCCGGTCCGGTGGGTGTCGCTAGCCCGGCCAAGTCTCGCCGCTCCACTCCGCGACACGAGCC
GGGCCACTCGTTCCAAAGTTCCGGCAGCAGTGCAGTTGATGTGATTGACCTGACCGGGTATCGTCTCTCCCTTCT
CGCTTCATGGTCGAATTCGACTGACTTTTTGGACAGAGACGACGTCGATCTCAATGCCGCCTGCGTCAGAGAGCA
GATCAAGCAGGAAAAGAGAAGCAAGCAAGAGATGAGGGACCGAAATATAGCCATGGAGATGGACCAGTCGTCCCA
GCTCAGCGAGTTGCCCCTTCCCGCTCCGACGTCGGGCCAAGGTCACACAAATGCCTTTTCCAAAATCATGGCCAC
GCAAAAGTCCAACGCTCAACGACCCATGGATGACTGGGACTGGCCGACGCAAGGCTCTTCCTCGTCCTCAAGCAA
TGCTTCTCTCCCGCCCATCATGCCCGGCACTTGGGTCGACGACGATGGCGACACGAAAGAGCTTATTCCCGGCTC
GCACGCCTATGCAGCGCGTGAGGCCTTTGGCGACTCGCTCCGGAATGCCTCTCTGCCGACACTTCCGCAGTCTCA
CCAGTCATTGCCGTCCTTTTCGAGCGTCTCTACCGGCCTCTACGTCCCGTCGCTGGGATCTAGGCACCCTCCTCA
CAGGCTTTTCGGCGGCGTGCCTCTACCACCAGTCCCGGGCAGCACGGGCTTGCATGACGTACTCAACAGAACCAG
CGGATTCGATTACTCTTCTCAAGTGGACGCCGACGGTAACCCCTTTTCGGAGCGGCTGTCGAGCTTCCTGCAGCA
CGCCTATCATGACACGCGATTCACGTCGAAGGAACTAGACGACTTGCTCCAGAACATCCGCCCGGACATGGACTT
ACCGGAGGGTGACCGGGACGGAACACCGGCGGGACTCAAGGATAAGCTCTACCGTCACCAGGAGCTCGCCTTGAC
TTGGATGAAGAACATGGAGCAGGGGACCAACAAGGGGGGCATCCTTGCAGACGACATGGGCCTAGGCAAGACGAT
ATCAACGTTGGCCCTGATCCTGGCGAGACCTCCCGCCACCGGCCTGCCCAAGGTGAGCCTCCCTGGCGTACGTAA
AGGTCATGACCGTTGCTTACGTTCTGACGCTGGACAGACGACGCTCGTCGTAGCCCCGGTGGCCCTGGTCAGCCA
GTGGCGGGAAGAAATCGTCAAGAAGACCAAACTCAGCCACCGTCTGTCCGTCTTCGTCTATCACAACAAGAAGGC
TACCGTGGACGAGCTCATGAAGTACGACGTTGTCATCACGACCTACGGCACCGTTGCGCAGGAATACGGACGCTA
CGACAAGTTCTGCACGGAAAACGGGACGCGAAACGTTGACATGAACGATCGCACCACGGCAACCAAGTTTTCGCT
GCTGCACCCGGGCAGGGCAAAGTTCTACCGAGTCGTGCTGGATGAGGCGCAGTGCATCAAGAACAAGAAGACTCG
GACGGCCAAGGCTTGCCAGTGGATCCAGGCCACGCATCGATGGTGTCTCACCGGCACGCCCATGATGAACAACGT
GGGCGAGCTCTATTCGCTCGTGCACTTCCTGAGGATCAGGCCCTACTGCGACTGGGACCACTTTCGAGATGTGAG
CAGACCCCCCTTTTCCCCCACCGTGCCTGCTGCCGTGCTGACGAGGCGTTGCAGGACTTTGGTACTCTCTTCGGT
GGACGCAAGGGTGAATCCAAGAAGATTGCCATGAGCAAGCTCAGGGCGCTCCTCAAGGCAATCATGCTGCGCCGC
AAGAAGGACTCGCAGCTGGACGGGAAACCCATCCTCAACCTACCGGCCAAGACGGAGAAGGTCGTTCACGCCACG
CTTTCGAGCGACGAGAGGGGATTCTACAAGCAGCTCGAGGAGAAGTCGCAAGTGCAGTTTAGCAAGTATCTGCGC
GACGGCACGGTCGGCAAGAATTACTCCAACATCCTCGTGCTACTGCTCCGCATGCGACAAGCCTGCTGCCATCCG
CATCTCAACGTCGACGTCGACGAAGTGAACACCGGGAGCGGCGAAGACGTCATCGAGGGCGTCAAGAACCTGAGC
AAGAGCGTGGTGGCAAGGATCAAGGCCAGGGAAGAATTCGAGTGCCCGATTTGCTTCGACGTGGTTCAGTCGCCC
ACCTTTTTCGTCCCCTGCGGCCACGACAGCTGCAGGGACTGTCTGGCGCGGCTGCTCGACGAGGCGACGACGCAG
AACCTTCACGCCGGCAACGAGAGCGACAAGGCCAAGTGCCCGCAGTGTCGCGGCGAGTTCCAAGCCAACAAGTGT
TTCTCTTACGAGACTTTCCGAAGCGTCCACATGCCCGAGACGGTTGCCGGGAACGATGACGACGGACCAGAGGCT
GACGAGAATGACGACGATGATGATGACGACGACGATGATGACGACGACTTTTCGGACTCGTGGACGGATCGGGAA
GACGATGCCGACGCGCACGGAAACCTGCGTAACTTTGTGGTCCCCGACGGTAGCGTCGACGACTTTGACTCGAGC
TCGACGGCGGCGGTGACATGGGAAAAGGCCCGTCACAAGGCGCGAAAGGGGAAGCGGAAGCAGACAGAAGTCAAG
CCGACGATGCTTCGCAGTCTGCGGAAGGAGGCGCTCAAGAACCGCGACGCCTACAAGCGGTACATGCGTTACCTC
CGCAAGACGTGGATGCCCTCGGCCAAGGTGACGGAGTGCATCAAGCTGCTCAAGCAGGTGCAGGAAGCGGGCGAA
AAGGCCATCGTCTTCTCCCAGTGGACGATGATGCTGGACCTGCTGCAGGTGGCCATGTGGCGTGAGAGCCTCCGC
AAGCCTGAGCGGTACGACGGCAGCATGTCAGGCGACGCGCGGGCGGCAGCGGCCCGGAGCTTCAGCAACGACTCT
CGCGTACGCGTCATGCTGGTGTCTCTGCGGGCGGGCAACGCTGGTCTGAACCTGACGGCCGCCAGCACCGTCATC
ATCATGGACCCCTTCTGGAACCCTTATATCGAGATGCAGGCCATTGACCGGGCACACCGCATCGGCCAGCAGCGA
GAGGTGAGCGTGTACCGCATCCTGGCAGAGGCGACGGTCGAGGACCGCATCATCCAGCTGCAGAAGCGCAAGAAG
GATCTGGTTGAGGCTGCCCTGGACGAGTCGGAGAGTATGAAGATTGGGAGGCTCAACGTCAACGAGCTCAAGTTT
TTGTTTAACACGAGGGATTAG

© 2022 - Robin Ohm - Utrecht University - The Netherlands

Built with Python Django and Wagtail