Fungal Genomics

at Utrecht University

General Properties

Protein IDOphcf2|00766
Gene name
Locationscaffold_01:2913234..2914991
Strand+
Gene length (bp)1757
Transcript length (bp)1494
Coding sequence length (bp)1494
Protein length (aa) 498

Overview

Your browser does not support drawing a protein figure.

PFAM Domains

PFAM Domain ID Short name Long name E-value Start End
PF00266 Aminotran_5 Aminotransferase class-V 8.1E-92 98 462
PF01041 DegT_DnrJ_EryC1 DegT/DnrJ/EryC1/StrS aminotransferase family 9.3E-07 142 280
PF01212 Beta_elim_lyase Beta-eliminating lyase 1.7E-06 139 276

GO

GO Term Description Terminal node
GO:0016829 lyase activity Yes
GO:0006520 cellular amino acid metabolic process Yes
GO:0006807 nitrogen compound metabolic process No
GO:0071704 organic substance metabolic process No
GO:0044238 primary metabolic process No
GO:0008152 metabolic process No
GO:1901564 organonitrogen compound metabolic process No
GO:0044281 small molecule metabolic process No
GO:0019752 carboxylic acid metabolic process No
GO:0003824 catalytic activity No
GO:0008150 biological_process No
GO:0006082 organic acid metabolic process No
GO:0043436 oxoacid metabolic process No
GO:0009987 cellular process No
GO:0003674 molecular_function No
GO:0044237 cellular metabolic process No

Deeploc

[Help with interpreting the results of Deeploc 2.0]
Localizations Signals Cytoplasm Nucleus Extracellular Cell membrane Mitochondrion Plastid Endoplasmic reticulum Lysosome vacuole Golgi apparatus Peroxisome
Mitochondrion Mitochondrial transit peptide 0.225 0.0955 0.0284 0.1189 0.9353 0.2848 0.0561 0.0328 0.1008 0.0232

SignalP

(None)

Transmembrane Domains

(None)

Transcription Factor Class

(None)

CAZymes

(None)

Secondary Metabolism

(None)

Expression data

Analysis 1: Expression analysis during behavioral modification. Published in: Will et al., G3, 2020

Click here for more information

Orthologs

Orthofinder run ID4
Orthogroup4268
Change Orthofinder run
Species Protein ID
Ophiocordyceps australis 1348a (Ghana) OphauG2|4535
Ophiocordyceps australis map64 (Brazil) OphauB2|5388
Ophiocordyceps camponoti-floridani Ophcf2|00766 (this protein)
Ophiocordyceps camponoti-rufipedis Ophun1|6212
Ophiocordyceps kimflemingae Ophio5|4454
Ophiocordyceps subramaniannii Hirsu2|8726

Sequences

Type of sequenceSequence
Locus Download genbank file of locus Download genbank file of locus (reverse complement)
The gene with 5 kb flanks (if sufficient flanking sequence is available). For use in cloning design programs. NOTE: features (genes or exons) that are only partially contained within the sequence are completely excluded.
Protein >Ophcf2|00766
MANLASRALRATARLAMTAPGRASSTTPAVAITAAVRRGYVTESRQDKANVETAIKLDKSDFADIPPPQMGGPAN
VTVSPMAEILKQATVMKEGQRPIYLDMQSTTPVDPRVLDAMLPYYVGVYGNPHSRTHAYGWESEKAVDEAREHVA
KLIGAESKEIIFTSGATESNNMSIKGVARFYGQGGKKKHVITSQTEHKCVLDSCRHLQDEGFQVTYLPVQSNGLI
RMSDLEAAIRPETVLVSIMAVNNEIGVIQPIQEIGEMCRKHRIFFHTDAAQAVGKIPLDVNAMNIDLMSISSHKI
YGPKGIGACFVRRRPRVRLDPIISGGGQERGLRSGTLAPPLVVGFGEACRVAKQEMEYDSKRIKTLSDRLLKGLL
AMEHTTQNGDANSFYPGCVNVSFAYVEGESLLMALKDIALSSGSACTSASLEPSYVLRALGNSDESAHSSIRFGI
GRFTTEMEIEYVLKAVQERVSFLRELSPLWELVQEGVDLSTISWSKH*
Coding >Ophcf2|00766
ATGGCCAATCTTGCATCTCGCGCGCTGAGGGCCACGGCCCGTCTGGCCATGACGGCTCCGGGCCGTGCCTCCTCG
ACTACGCCGGCCGTCGCCATTACCGCCGCTGTCCGGCGCGGATACGTGACCGAGTCGAGGCAGGACAAGGCAAAT
GTCGAGACGGCCATCAAGCTGGATAAGTCAGACTTTGCCGACATTCCGCCTCCTCAGATGGGAGGTCCCGCCAAC
GTGACCGTCAGCCCCATGGCCGAAATTCTGAAGCAAGCGACCGTCATGAAGGAGGGTCAGCGGCCCATCTACCTC
GACATGCAGTCTACCACTCCCGTCGATCCCCGCGTGCTCGATGCCATGCTCCCCTATTACGTCGGCGTCTACGGC
AATCCTCATTCCCGAACGCACGCCTACGGCTGGGAGAGTGAAAAGGCCGTCGACGAGGCGCGGGAACACGTCGCC
AAGCTCATCGGCGCCGAGTCCAAGGAAATCATCTTTACCAGCGGTGCCACCGAGAGCAACAACATGAGCATCAAG
GGCGTCGCTCGCTTCTACGGTCAAGGCGGCAAGAAGAAGCACGTCATCACCAGCCAGACCGAACACAAGTGCGTC
CTCGACAGCTGCCGGCATCTGCAGGATGAGGGCTTCCAAGTCACCTATCTGCCCGTCCAGAGCAACGGGCTCATC
CGGATGAGCGACCTCGAGGCCGCCATCCGGCCAGAGACTGTCCTGGTCAGCATCATGGCCGTCAACAACGAGATT
GGCGTCATCCAGCCCATCCAAGAGATTGGCGAGATGTGCCGCAAGCACCGCATCTTCTTTCACACAGACGCCGCT
CAGGCCGTCGGCAAGATCCCGCTCGACGTGAACGCCATGAACATCGACCTCATGTCCATCTCGTCGCACAAGATC
TACGGTCCCAAGGGTATCGGTGCCTGCTTTGTACGCCGGCGGCCCCGTGTCCGGCTGGATCCCATCATATCCGGC
GGCGGCCAGGAACGTGGTCTGCGGAGTGGTACGCTGGCACCGCCCCTGGTTGTCGGATTTGGCGAGGCCTGTCGC
GTGGCCAAACAGGAGATGGAATACGACTCGAAGCGAATCAAGACCCTTTCGGACCGACTTCTCAAAGGCCTTTTG
GCCATGGAGCACACGACGCAAAACGGCGACGCGAACTCGTTCTACCCCGGCTGCGTCAACGTCTCATTCGCCTAC
GTCGAAGGCGAGTCGTTGCTCATGGCGCTCAAGGACATTGCGCTATCGTCAGGGAGCGCGTGCACCTCGGCCTCG
CTGGAACCGAGCTACGTGCTGCGAGCACTGGGCAACAGCGACGAGAGCGCACACAGCAGCATCCGCTTCGGCATC
GGGCGCTTCACGACGGAGATGGAGATTGAGTACGTGCTCAAGGCGGTGCAGGAGCGAGTGAGCTTCTTGCGGGAG
CTGAGCCCACTGTGGGAGCTGGTCCAGGAGGGCGTCGATCTGAGCACCATCAGCTGGAGCAAACACTGA
Transcript >Ophcf2|00766
ATGGCCAATCTTGCATCTCGCGCGCTGAGGGCCACGGCCCGTCTGGCCATGACGGCTCCGGGCCGTGCCTCCTCG
ACTACGCCGGCCGTCGCCATTACCGCCGCTGTCCGGCGCGGATACGTGACCGAGTCGAGGCAGGACAAGGCAAAT
GTCGAGACGGCCATCAAGCTGGATAAGTCAGACTTTGCCGACATTCCGCCTCCTCAGATGGGAGGTCCCGCCAAC
GTGACCGTCAGCCCCATGGCCGAAATTCTGAAGCAAGCGACCGTCATGAAGGAGGGTCAGCGGCCCATCTACCTC
GACATGCAGTCTACCACTCCCGTCGATCCCCGCGTGCTCGATGCCATGCTCCCCTATTACGTCGGCGTCTACGGC
AATCCTCATTCCCGAACGCACGCCTACGGCTGGGAGAGTGAAAAGGCCGTCGACGAGGCGCGGGAACACGTCGCC
AAGCTCATCGGCGCCGAGTCCAAGGAAATCATCTTTACCAGCGGTGCCACCGAGAGCAACAACATGAGCATCAAG
GGCGTCGCTCGCTTCTACGGTCAAGGCGGCAAGAAGAAGCACGTCATCACCAGCCAGACCGAACACAAGTGCGTC
CTCGACAGCTGCCGGCATCTGCAGGATGAGGGCTTCCAAGTCACCTATCTGCCCGTCCAGAGCAACGGGCTCATC
CGGATGAGCGACCTCGAGGCCGCCATCCGGCCAGAGACTGTCCTGGTCAGCATCATGGCCGTCAACAACGAGATT
GGCGTCATCCAGCCCATCCAAGAGATTGGCGAGATGTGCCGCAAGCACCGCATCTTCTTTCACACAGACGCCGCT
CAGGCCGTCGGCAAGATCCCGCTCGACGTGAACGCCATGAACATCGACCTCATGTCCATCTCGTCGCACAAGATC
TACGGTCCCAAGGGTATCGGTGCCTGCTTTGTACGCCGGCGGCCCCGTGTCCGGCTGGATCCCATCATATCCGGC
GGCGGCCAGGAACGTGGTCTGCGGAGTGGTACGCTGGCACCGCCCCTGGTTGTCGGATTTGGCGAGGCCTGTCGC
GTGGCCAAACAGGAGATGGAATACGACTCGAAGCGAATCAAGACCCTTTCGGACCGACTTCTCAAAGGCCTTTTG
GCCATGGAGCACACGACGCAAAACGGCGACGCGAACTCGTTCTACCCCGGCTGCGTCAACGTCTCATTCGCCTAC
GTCGAAGGCGAGTCGTTGCTCATGGCGCTCAAGGACATTGCGCTATCGTCAGGGAGCGCGTGCACCTCGGCCTCG
CTGGAACCGAGCTACGTGCTGCGAGCACTGGGCAACAGCGACGAGAGCGCACACAGCAGCATCCGCTTCGGCATC
GGGCGCTTCACGACGGAGATGGAGATTGAGTACGTGCTCAAGGCGGTGCAGGAGCGAGTGAGCTTCTTGCGGGAG
CTGAGCCCACTGTGGGAGCTGGTCCAGGAGGGCGTCGATCTGAGCACCATCAGCTGGAGCAAACACTGA
Gene >Ophcf2|00766
ATGGCCAATCTTGCATCTCGCGCGCTGAGGGCCACGGCCCGTCTGGCCATGACGGCTCCGGGCCGTGCCTCCTCG
ACTACGCCGGCCGTCGCCATTACCGCCGCTGTCCGGCGCGGATACGTGACCGAGTCGAGGCAGGACAAGGCAAAT
GTCGAGACGGCCATCAAGCTGGATAAGTCAGACTTTGCCGACATTCCGCCTCCTCAGATGGGAGGTCCCGCCAAC
GTGACCGTCAGCCCCATGGCCGGTATGTTGAGCCGTCCTCGCCACCCACGATGTCGCCGTTGACCTGTGCGTGAT
TATGCAGAAATTCTGAAGCAAGCGACCGTCATGAAGGAGGGTCAGCGGCCCATCTACCTCGACATGCAGTCTACC
ACTCCCGTCGATCCCCGCGTGCTCGATGCCATGCTCCCCTATTACGTCGGCGTCTACGGCAATCCTCATTCCCGA
ACGCACGCCTACGGCTGGGAGAGTGAAAAGGCCGTCGACGAGGCGCGGGAACACGTCGCCAAGCTCATCGGCGCC
GAGTCCAAGGAAATCATCTTTACCAGCGGTGCCACCGAGAGCAACAACATGAGCATCAAGGGCGTCGCTCGCTTC
TACGGTCAAGGCGGCAAGAAGAAGCACGTCATCACCAGCCAGACCGAACACAAGTGCGTCCTCGACAGCTGCCGG
CATCTGCAGGATGAGGGCTTCCAAGTCACCTATCTGCCCGTCCAGAGCAACGGGCTCATCCGGATGAGCGACCTC
GAGGCCGCCATCCGGCCAGAGACTGTCCTGGTCAGCATCATGGCCGTCAACAACGAGATTGGCGTCATCCAGCCC
ATCCAAGAGATTGGCGAGATGTGCCGCAAGCACCGCATCTTCTTTCACACAGACGCCGCTCAGGCCGTCGGCAAG
ATCCCGCTCGACGTGAACGCCATGAACATCGACCTCATGTCCATCTCGTCGCACAAGATCTACGGTCCCAAGGGT
ATCGGTGCCTGCTTTGTACGCCGGCGGCCCCGTGTCCGGCTGGATCCCATCATATCCGGCGGCGGCCAGGAACGT
GGTCTGCGGAGTGGTACGCTGGCACCGCCCCTGGTTGTCGGATTTGGCGAGGCCTGTCGCGTGGCCAAACAGGAG
ATGGAAGTATGTCGTCACACCCCGTCGCGAATCCCGTCTGCGCATGATGATTTGCTCTTTTCTTGCATGGCTTTC
TGAACGGCCCGTGACAAGGCCGTCCGTGTTGAGGAAAGCAACTTTTATGTTTTGTCTGACGCCAGACCTGACTGT
TCCCCTCTCGTTGATGCATCTCTGGGCTTTGAGGTTCGGGCGGCTGACGACATGGGCAGTACGACTCGAAGCGAA
TCAAGACCCTTTCGGACCGACTTCTCAAAGGCCTTTTGGCCATGGAGCACACGACGCAAAACGGCGACGCGAACT
CGTTCTACCCCGGCTGCGTCAACGTCTCATTCGCCTACGTCGAAGGCGAGTCGTTGCTCATGGCGCTCAAGGACA
TTGCGCTATCGTCAGGGAGCGCGTGCACCTCGGCCTCGCTGGAACCGAGCTACGTGCTGCGAGCACTGGGCAACA
GCGACGAGAGCGCACACAGCAGCATCCGCTTCGGCATCGGGCGCTTCACGACGGAGATGGAGATTGAGTACGTGC
TCAAGGCGGTGCAGGAGCGAGTGAGCTTCTTGCGGGAGCTGAGCCCACTGTGGGAGCTGGTCCAGGAGGGCGTCG
ATCTGAGCACCATCAGCTGGAGCAAACACTGA

© 2023 - Robin Ohm - Utrecht University - The Netherlands

Built with Python Django and Wagtail