Fungal Genomics

at Utrecht University

General Properties

Protein IDOphcf2|00765
Gene name
Locationscaffold_01:2911208..2912632
Strand-
Gene length (bp)1424
Transcript length (bp)1287
Coding sequence length (bp)1287
Protein length (aa) 429

Overview

Your browser does not support drawing a protein figure.

PFAM Domains

PFAM Domain ID Short name Long name E-value Start End
PF03114 BAR BAR domain 1.2E-65 7 246
PF00018 SH3_1 SH3 domain 4.2E-15 375 421
PF14604 SH3_9 Variant SH3 domain 5.6E-11 376 425
PF07653 SH3_2 Variant SH3 domain 4.0E-09 376 427

GO

GO Term Description Terminal node
GO:0005737 cytoplasm Yes
GO:0005515 protein binding Yes
GO:0005575 cellular_component No
GO:0003674 molecular_function No
GO:0110165 cellular anatomical entity No
GO:0005488 binding No

Deeploc

[Help with interpreting the results of Deeploc 2.0]
Localizations Signals Cytoplasm Nucleus Extracellular Cell membrane Mitochondrion Plastid Endoplasmic reticulum Lysosome vacuole Golgi apparatus Peroxisome
Cytoplasm 0.6442 0.1775 0.1348 0.1586 0.1548 0.0013 0.4107 0.33 0.3311 0.0072

SignalP

(None)

Transmembrane Domains

(None)

Transcription Factor Class

(None)

CAZymes

(None)

Secondary Metabolism

(None)

Expression data

Analysis 1: Expression analysis during behavioral modification. Published in: Will et al., G3, 2020

Click here for more information

Orthologs

Orthofinder run ID4
Orthogroup2576
Change Orthofinder run
Species Protein ID
Ophiocordyceps australis 1348a (Ghana) OphauG2|4534
Ophiocordyceps australis map64 (Brazil) OphauB2|5389
Ophiocordyceps camponoti-floridani Ophcf2|00765 (this protein)
Ophiocordyceps camponoti-rufipedis Ophun1|6213
Ophiocordyceps kimflemingae Ophio5|4455
Ophiocordyceps subramaniannii Hirsu2|3860

Sequences

Type of sequenceSequence
Locus Download genbank file of locus Download genbank file of locus (reverse complement)
The gene with 5 kb flanks (if sufficient flanking sequence is available). For use in cloning design programs. NOTE: features (genes or exons) that are only partially contained within the sequence are completely excluded.
Protein >Ophcf2|00765
MSFKGFQRTITRAPQQIKSKFNIGEHTKDAVYIDAERRFQELETETKRLHDESKKYSDAINGMLNHQIIFSQAMT
EIYRPISGRVSDPDSMQIEGIPEGIRACEEYESIVKELQLTLNPELEMIETRIIRPANELLDVIKVIRKTVLKRE
HKRLDYDRHRAAYKKLYDKKDRSAKDEKALWKAEGEVEQSTQDFEYYNDLLKDELPRLFVLEQNFIQPLFQSFYY
MQLNIFYTLHERMQRCDIGYFDLTRDIEEAFHDKRGEIQDRAEALAICRFKTTGRPRPPRYNRPPLEPGKKPALL
TAGPSSASGSSSKAGAYSRQSIDSGEQHAPPPYTAAQPPSSPSSLSAMAASKPKPPPPKPKPSRLSGVPGVETVT
ALYDFSAQTEGDLSFRTGDVIEIVQRTDNENEWWTGRLQGKQGQFPGNYVRVN*
Coding >Ophcf2|00765
ATGAGCTTCAAGGGCTTTCAAAGGACCATCACGCGGGCGCCGCAGCAGATCAAGTCCAAATTCAACATCGGCGAA
CACACCAAGGATGCCGTCTACATCGACGCCGAACGCCGCTTTCAGGAGCTCGAGACGGAGACGAAACGACTCCAT
GACGAGTCGAAAAAGTACTCCGACGCCATCAACGGCATGCTCAACCATCAAATCATCTTTAGCCAGGCCATGACG
GAGATATATCGTCCCATCTCCGGACGCGTCTCCGATCCGGACTCGATGCAGATCGAGGGCATCCCCGAGGGCATT
CGCGCATGCGAAGAGTACGAGTCCATCGTCAAGGAGCTGCAGCTGACGCTCAACCCGGAATTGGAGATGATTGAG
ACGAGAATCATCCGACCGGCCAACGAGCTCCTCGATGTCATCAAAGTCATCCGCAAGACGGTTCTCAAGCGTGAA
CACAAGAGGCTCGACTACGATCGCCATCGGGCCGCTTACAAGAAGCTCTACGACAAGAAGGACCGGTCGGCCAAG
GACGAAAAGGCGCTCTGGAAAGCCGAGGGCGAGGTCGAGCAGTCGACGCAGGACTTTGAGTACTATAACGATCTC
CTCAAAGACGAGCTGCCCCGACTCTTCGTGCTCGAGCAAAACTTTATCCAGCCGCTGTTCCAGTCGTTTTACTAC
ATGCAGCTCAACATCTTTTACACGCTACACGAGCGCATGCAGCGCTGCGACATTGGCTACTTTGACCTGACGCGC
GACATAGAAGAGGCCTTTCACGACAAGCGCGGCGAGATTCAAGACCGTGCCGAGGCTCTGGCCATCTGCCGCTTC
AAGACGACGGGCAGGCCACGGCCTCCACGCTACAACCGCCCACCCCTGGAACCCGGTAAGAAGCCGGCGCTCCTG
ACAGCCGGTCCGAGCAGCGCGTCGGGCTCCTCGTCAAAGGCGGGCGCCTACTCTCGCCAGTCCATCGACTCGGGC
GAGCAACACGCGCCTCCGCCATACACTGCCGCCCAACCGCCGTCCAGTCCTTCGAGTCTGTCGGCCATGGCCGCC
TCCAAGCCCAAGCCTCCGCCGCCGAAACCCAAGCCTAGCCGTTTGAGTGGCGTCCCGGGCGTGGAGACGGTGACT
GCCCTGTACGACTTCTCGGCGCAGACCGAGGGCGACCTCAGCTTCCGCACCGGTGACGTCATTGAAATCGTGCAG
AGGACGGACAACGAGAACGAGTGGTGGACCGGACGTCTTCAGGGGAAGCAAGGCCAATTCCCAGGCAACTACGTC
AGGGTGAACTGA
Transcript >Ophcf2|00765
ATGAGCTTCAAGGGCTTTCAAAGGACCATCACGCGGGCGCCGCAGCAGATCAAGTCCAAATTCAACATCGGCGAA
CACACCAAGGATGCCGTCTACATCGACGCCGAACGCCGCTTTCAGGAGCTCGAGACGGAGACGAAACGACTCCAT
GACGAGTCGAAAAAGTACTCCGACGCCATCAACGGCATGCTCAACCATCAAATCATCTTTAGCCAGGCCATGACG
GAGATATATCGTCCCATCTCCGGACGCGTCTCCGATCCGGACTCGATGCAGATCGAGGGCATCCCCGAGGGCATT
CGCGCATGCGAAGAGTACGAGTCCATCGTCAAGGAGCTGCAGCTGACGCTCAACCCGGAATTGGAGATGATTGAG
ACGAGAATCATCCGACCGGCCAACGAGCTCCTCGATGTCATCAAAGTCATCCGCAAGACGGTTCTCAAGCGTGAA
CACAAGAGGCTCGACTACGATCGCCATCGGGCCGCTTACAAGAAGCTCTACGACAAGAAGGACCGGTCGGCCAAG
GACGAAAAGGCGCTCTGGAAAGCCGAGGGCGAGGTCGAGCAGTCGACGCAGGACTTTGAGTACTATAACGATCTC
CTCAAAGACGAGCTGCCCCGACTCTTCGTGCTCGAGCAAAACTTTATCCAGCCGCTGTTCCAGTCGTTTTACTAC
ATGCAGCTCAACATCTTTTACACGCTACACGAGCGCATGCAGCGCTGCGACATTGGCTACTTTGACCTGACGCGC
GACATAGAAGAGGCCTTTCACGACAAGCGCGGCGAGATTCAAGACCGTGCCGAGGCTCTGGCCATCTGCCGCTTC
AAGACGACGGGCAGGCCACGGCCTCCACGCTACAACCGCCCACCCCTGGAACCCGGTAAGAAGCCGGCGCTCCTG
ACAGCCGGTCCGAGCAGCGCGTCGGGCTCCTCGTCAAAGGCGGGCGCCTACTCTCGCCAGTCCATCGACTCGGGC
GAGCAACACGCGCCTCCGCCATACACTGCCGCCCAACCGCCGTCCAGTCCTTCGAGTCTGTCGGCCATGGCCGCC
TCCAAGCCCAAGCCTCCGCCGCCGAAACCCAAGCCTAGCCGTTTGAGTGGCGTCCCGGGCGTGGAGACGGTGACT
GCCCTGTACGACTTCTCGGCGCAGACCGAGGGCGACCTCAGCTTCCGCACCGGTGACGTCATTGAAATCGTGCAG
AGGACGGACAACGAGAACGAGTGGTGGACCGGACGTCTTCAGGGGAAGCAAGGCCAATTCCCAGGCAACTACGTC
AGGGTGAACTGA
Gene >Ophcf2|00765
ATGAGCTTCAAGGGCTTTCAAAGGACCATCACGCGGGTGCGAAACATCCTCTTCCCCCCCCCCCTCACTTGGGTC
TCGTCTGCTGACGAAAAGACGCACAAAAATAGGCGCCGCAGCAGATCAAGTCCAAATTCAACATCGGCGAACACA
CCAAGGATGCCGTCTACATCGACGCCGAACGCCGCTTTCAGGAGCTCGAGACGGAGACGAAACGACTCCATGACG
AGTCGAAAAAGTACTCCGACGCCATCAACGGCATGCTCAACCATCAAATCATCTTTAGCCAGGCCATGACGGAGA
TATATCGTCCCATCTCCGGACGCGTCTCCGATCCGGACTCGATGCAGATCGAGGGCATCCCCGAGGGCATTCGCG
CATGCGAAGAGTACGAGTCCATCGTCAAGGAGCTGCAGCTGACGCTCAACCCGGAATTGGAGATGATTGAGACGA
GAATCATCCGACCGGCCAACGAGCTCCTCGATGTCATCAAAGTCATCCGCAAGACGGTTCTCAAGCGTGAACACA
AGAGGCTCGACTACGATCGCCATCGGGCCGCTTACAAGAAGCTCTACGACAAGAAGGACCGGTCGGCCAAGGACG
AAAAGGCGCTCTGGAAAGCCGAGGGCGAGGTCGAGCAGTCGACGCAGGACTTTGAGTACTATAACGATCTCCTCA
AAGACGAGCTGCCCCGACTCTTCGTGCTCGAGCAAAACTTTATCCAGCCGCTGTTCCAGTCGTTTTACTACATGC
AGCTCAACATCTTTTACACGCTACACGAGCGCATGCAGCGCTGCGACATTGGCTACTTTGACCTGACGCGCGACA
TAGAAGAGGCCTTTCACGACAAGCGCGGCGAGATTCAAGACCGTGCCGAGGCTCTGGCCATCTGCCGCTTCAAGA
CGACGGGCAGGCCACGGCCTCCACGCTACAACCGCCCACCCCTGGAACCCGGTAAGAAGCCGGCGCTCCTGACAG
CCGGTCCGAGCAGCGCGTCGGGCTCCTCGTCAAAGGCGGGCGCCTACTCTCGCCAGTCCATCGACTCGGGCGAGC
AACACGCGCCTCCGCCATACACTGCCGCCCAACCGCCGTCCAGTCCTTCGAGTCTGTCGGCCATGGCCGCCTCCA
AGCCCAAGCCTCCGCCGCCGAAACCCAAGCCTAGCCGTTTGAGTGGCGTCCCGGGCGTGGAGACGGTGACTGCCC
TGTACGACTTCTCGGCGCAGACCGAGGGCGACCTCAGCTTCCGCACCGGTGACGTCATTGAAATCGTGCAGAGGA
CGGACAACGAGAACGAGTGGTGGACCGGACGTCTTCAGGGGAAGCAAGGCCAATTCCCAGGTGAGGATGGCAGGC
ATCATGAGAAATGCGCCCCGGGCTCGGCCGCTGACGAGGATTTGACACCAGGCAACTACGTCAGGGTGAACTGA

© 2023 - Robin Ohm - Utrecht University - The Netherlands

Built with Python Django and Wagtail