Fungal Genomics

at Utrecht University

General Properties

Protein IDOphcf2|00762
Gene name
Locationscaffold_01:2905398..2906686
Strand-
Gene length (bp)1288
Transcript length (bp)1170
Coding sequence length (bp)1170
Protein length (aa) 390

Your browser does not support drawing a protein figure.

PFAM Domains

PFAM Domain ID Short name Long name E-value Start End
PF01940 DUF92 Integral membrane protein DUF92 5.5E-85 9 368

GO

GO Term Description Terminal node
GO:0016021 integral component of membrane Yes
GO:0005575 cellular_component No
GO:0031224 intrinsic component of membrane No
GO:0110165 cellular anatomical entity No

SignalP

[Help with interpreting these statistics]
SignalP signal predicted Location
(based on Ymax)
D score
(significance: > 0.45)
No 1 - 20 0.5

Transmembrane Domains

Domain # Start End Length
1 39 58 19
2 183 205 22
3 230 252 22
4 359 381 22

Transcription Factor Class

(None)

Expression data

Analysis 1: Expression analysis during behavioral modification. Published in: Will et al., G3, 2020

Expression values

Label Description Expression (RPKM) Confidence interval (low) Confidence interval (high)
Fungus Fungus in pure culture 166.31 92.47 240.15
Alive In ants, during behavior modification 25.45 12.22 38.69
Dead In ants, recently dead 40.59 21.73 59.45

Differential expression

Label1 Label2 Q-value Significant difference
Alive Fungus 0.000238 yes
Alive Dead 0.008883 yes
Dead Fungus 0.000238 yes

Sequences

Type of sequenceSequence
Locus Download genbank file of locus
The gene with 5 kb flanks (if sufficient flanking sequence is available). For use in cloning design programs. NOTE: features (genes or exons) that are only partially contained within the sequence are completely excluded.
Protein >Ophcf2|00762
MKPILALPLTAALVLRAWKQKSLTPGGILAAALTALAHAYHPWNLPFVLLLVFFLAGTRVTHVKEKVKATLTQTS
SGSSGGEGPRTHVQVFANSLMASMLSLMHAYQLRSRQAAFADADGRNPQGTKCFSWGGDVLVIGIIANYAAVAAD
TFSSELGILASSQPRLITSLSLRKVPRGTNGGVTVEGLAAGLLGSMVIVTAAMLFLPTCSPETAAMPGGGVPWTV
GQRRVLMGFLVVWGALGSLLDSFLGGLLQRSIRDVRSGKIIEGEGGNRVLVAAGSGRVAGGSVKRAEAKTAALSG
QVGTTDGEVSVEESAVDDERDTTDRRALEGEHRRRGSFGDDGPSRIVESGLDILDNNDVNFLMASMMSIGAMAVA
SWYWGLDVDSVTRI*
Coding >Ophcf2|00762
ATGAAACCCATCTTGGCACTTCCGCTAACGGCAGCGCTCGTGCTGCGGGCGTGGAAGCAGAAGTCGCTCACGCCA
GGCGGCATCTTGGCGGCCGCTCTGACGGCTCTCGCCCACGCCTATCACCCGTGGAACCTACCCTTTGTCCTCCTC
CTCGTCTTCTTTCTCGCCGGGACGCGAGTGACGCATGTTAAGGAGAAGGTCAAGGCCACCCTGACCCAGACCTCG
AGCGGCAGTTCAGGGGGCGAAGGGCCTCGAACCCATGTTCAAGTCTTCGCCAACTCCCTCATGGCATCGATGCTC
TCCCTGATGCACGCCTATCAACTCCGTTCAAGGCAAGCTGCATTCGCCGACGCCGACGGCCGCAACCCCCAAGGC
ACGAAATGCTTCTCATGGGGCGGAGACGTGCTCGTCATCGGCATCATAGCCAACTACGCCGCAGTCGCAGCCGAC
ACCTTCAGCTCGGAGCTCGGTATCCTAGCGAGCAGCCAGCCGCGGCTCATCACATCCCTGAGCCTGCGAAAGGTG
CCCCGCGGCACCAATGGGGGCGTAACCGTGGAGGGGCTGGCCGCGGGCCTCCTCGGCTCCATGGTGATTGTAACG
GCGGCGATGCTCTTTCTGCCCACGTGCAGTCCCGAGACGGCAGCCATGCCAGGCGGCGGCGTGCCGTGGACGGTG
GGGCAGCGCAGGGTGTTGATGGGCTTCCTGGTGGTCTGGGGCGCGCTTGGCAGCCTGCTCGACAGCTTCCTTGGT
GGGCTCCTCCAGCGCTCGATCAGGGACGTGCGCTCGGGAAAGATTATTGAGGGCGAGGGTGGCAACCGAGTCCTG
GTCGCGGCAGGGTCGGGGCGGGTCGCCGGGGGTTCGGTAAAGCGTGCCGAGGCGAAGACAGCGGCGCTCAGTGGA
CAGGTTGGGACGACGGACGGGGAGGTTTCAGTGGAGGAGTCTGCCGTGGACGATGAGCGCGACACGACGGACAGA
CGGGCGCTGGAGGGCGAGCACCGGCGCAGAGGAAGCTTCGGGGACGACGGCCCATCTCGGATCGTGGAGAGCGGG
CTCGACATACTGGACAACAACGACGTCAATTTCCTCATGGCGTCGATGATGAGCATCGGAGCGATGGCGGTGGCG
AGCTGGTACTGGGGGCTGGACGTTGACAGTGTCACGAGAATCTGA
Transcript >Ophcf2|00762
ATGAAACCCATCTTGGCACTTCCGCTAACGGCAGCGCTCGTGCTGCGGGCGTGGAAGCAGAAGTCGCTCACGCCA
GGCGGCATCTTGGCGGCCGCTCTGACGGCTCTCGCCCACGCCTATCACCCGTGGAACCTACCCTTTGTCCTCCTC
CTCGTCTTCTTTCTCGCCGGGACGCGAGTGACGCATGTTAAGGAGAAGGTCAAGGCCACCCTGACCCAGACCTCG
AGCGGCAGTTCAGGGGGCGAAGGGCCTCGAACCCATGTTCAAGTCTTCGCCAACTCCCTCATGGCATCGATGCTC
TCCCTGATGCACGCCTATCAACTCCGTTCAAGGCAAGCTGCATTCGCCGACGCCGACGGCCGCAACCCCCAAGGC
ACGAAATGCTTCTCATGGGGCGGAGACGTGCTCGTCATCGGCATCATAGCCAACTACGCCGCAGTCGCAGCCGAC
ACCTTCAGCTCGGAGCTCGGTATCCTAGCGAGCAGCCAGCCGCGGCTCATCACATCCCTGAGCCTGCGAAAGGTG
CCCCGCGGCACCAATGGGGGCGTAACCGTGGAGGGGCTGGCCGCGGGCCTCCTCGGCTCCATGGTGATTGTAACG
GCGGCGATGCTCTTTCTGCCCACGTGCAGTCCCGAGACGGCAGCCATGCCAGGCGGCGGCGTGCCGTGGACGGTG
GGGCAGCGCAGGGTGTTGATGGGCTTCCTGGTGGTCTGGGGCGCGCTTGGCAGCCTGCTCGACAGCTTCCTTGGT
GGGCTCCTCCAGCGCTCGATCAGGGACGTGCGCTCGGGAAAGATTATTGAGGGCGAGGGTGGCAACCGAGTCCTG
GTCGCGGCAGGGTCGGGGCGGGTCGCCGGGGGTTCGGTAAAGCGTGCCGAGGCGAAGACAGCGGCGCTCAGTGGA
CAGGTTGGGACGACGGACGGGGAGGTTTCAGTGGAGGAGTCTGCCGTGGACGATGAGCGCGACACGACGGACAGA
CGGGCGCTGGAGGGCGAGCACCGGCGCAGAGGAAGCTTCGGGGACGACGGCCCATCTCGGATCGTGGAGAGCGGG
CTCGACATACTGGACAACAACGACGTCAATTTCCTCATGGCGTCGATGATGAGCATCGGAGCGATGGCGGTGGCG
AGCTGGTACTGGGGGCTGGACGTTGACAGTGTCACGAGAATCTGA
Gene >Ophcf2|00762
ATGAAACCCATCTTGGCACTTCCGCTAACGGCAGCGCTCGTGCTGCGGGCGTGGAAGCAGAAGTCGCTCACGCCA
GGCGGCATCTTGGCGGCCGCTCTGACGGCTCTCGCCCACGCCTATCACCCGTGGAACCTACCCTTTGTCCTCCTC
CTCGTCTTCTTTCTCGCCGGGACGCGAGTGACGCATGTATGTACAGTCGTCGTCCAGTCGTTACCGGTCAGGTGG
TCGCTGACGTGACATTTCCCAGGTTAAGGAGAAGGTCAAGGCCACCCTGACCCAGACCTCGAGCGGCAGTTCAGG
GGGCGAAGGGCCTCGAACCCATGTTCAAGGTGTGTTGATCCGTGCTCGCCGCTGCAGCTTTCAGGTGGCTCACGC
AACGGTTCCAGTCTTCGCCAACTCCCTCATGGCATCGATGCTCTCCCTGATGCACGCCTATCAACTCCGTTCAAG
GCAAGCTGCATTCGCCGACGCCGACGGCCGCAACCCCCAAGGCACGAAATGCTTCTCATGGGGCGGAGACGTGCT
CGTCATCGGCATCATAGCCAACTACGCCGCAGTCGCAGCCGACACCTTCAGCTCGGAGCTCGGTATCCTAGCGAG
CAGCCAGCCGCGGCTCATCACATCCCTGAGCCTGCGAAAGGTGCCCCGCGGCACCAATGGGGGCGTAACCGTGGA
GGGGCTGGCCGCGGGCCTCCTCGGCTCCATGGTGATTGTAACGGCGGCGATGCTCTTTCTGCCCACGTGCAGTCC
CGAGACGGCAGCCATGCCAGGCGGCGGCGTGCCGTGGACGGTGGGGCAGCGCAGGGTGTTGATGGGCTTCCTGGT
GGTCTGGGGCGCGCTTGGCAGCCTGCTCGACAGCTTCCTTGGTGGGCTCCTCCAGCGCTCGATCAGGGACGTGCG
CTCGGGAAAGATTATTGAGGGCGAGGGTGGCAACCGAGTCCTGGTCGCGGCAGGGTCGGGGCGGGTCGCCGGGGG
TTCGGTAAAGCGTGCCGAGGCGAAGACAGCGGCGCTCAGTGGACAGGTTGGGACGACGGACGGGGAGGTTTCAGT
GGAGGAGTCTGCCGTGGACGATGAGCGCGACACGACGGACAGACGGGCGCTGGAGGGCGAGCACCGGCGCAGAGG
AAGCTTCGGGGACGACGGCCCATCTCGGATCGTGGAGAGCGGGCTCGACATACTGGACAACAACGACGTCAATTT
CCTCATGGCGTCGATGATGAGCATCGGAGCGATGGCGGTGGCGAGCTGGTACTGGGGGCTGGACGTTGACAGTGT
CACGAGAATCTGA

© 2022 - Robin Ohm - Utrecht University - The Netherlands

Built with Python Django and Wagtail