Fungal Genomics

at Utrecht University

General Properties

Protein IDOphcf2|00761
Gene name
Locationscaffold_01:2902201..2903697
Strand-
Gene length (bp)1496
Transcript length (bp)1077
Coding sequence length (bp)1077
Protein length (aa) 359

Overview

Your browser does not support drawing a protein figure.

PFAM Domains

PFAM Domain ID Short name Long name E-value Start End
PF00120 Gln-synt_C Glutamine synthetase, catalytic domain 7.2E-11 171 257
PF03951 Gln-synt_N Glutamine synthetase, beta-Grasp domain 2.7E-10 27 102

GO

GO Term Description Terminal node
GO:0006807 nitrogen compound metabolic process Yes
GO:0004356 glutamate-ammonia ligase activity Yes
GO:0006542 glutamine biosynthetic process Yes
GO:0044283 small molecule biosynthetic process No
GO:0006541 glutamine metabolic process No
GO:0003824 catalytic activity No
GO:0008652 cellular amino acid biosynthetic process No
GO:0006520 cellular amino acid metabolic process No
GO:1901566 organonitrogen compound biosynthetic process No
GO:1901576 organic substance biosynthetic process No
GO:0009058 biosynthetic process No
GO:0008152 metabolic process No
GO:1901564 organonitrogen compound metabolic process No
GO:0019752 carboxylic acid metabolic process No
GO:0016880 acid-ammonia (or amide) ligase activity No
GO:0009987 cellular process No
GO:0043436 oxoacid metabolic process No
GO:0044237 cellular metabolic process No
GO:0044281 small molecule metabolic process No
GO:0016053 organic acid biosynthetic process No
GO:0044238 primary metabolic process No
GO:0009064 glutamine family amino acid metabolic process No
GO:0016874 ligase activity No
GO:0016211 ammonia ligase activity No
GO:0003674 molecular_function No
GO:1901605 alpha-amino acid metabolic process No
GO:0009084 glutamine family amino acid biosynthetic process No
GO:1901607 alpha-amino acid biosynthetic process No
GO:0044249 cellular biosynthetic process No
GO:0046394 carboxylic acid biosynthetic process No
GO:0006082 organic acid metabolic process No
GO:0008150 biological_process No
GO:0016879 ligase activity, forming carbon-nitrogen bonds No
GO:0071704 organic substance metabolic process No

Deeploc

[Help with interpreting the results of Deeploc 2.0]
Localizations Signals Cytoplasm Nucleus Extracellular Cell membrane Mitochondrion Plastid Endoplasmic reticulum Lysosome vacuole Golgi apparatus Peroxisome
Cytoplasm Nuclear localization signal 0.5902 0.4601 0.1082 0.2283 0.2096 0.0609 0.0367 0.1147 0.0611 0.0041

SignalP

(None)

Transmembrane Domains

(None)

Transcription Factor Class

(None)

CAZymes

(None)

Secondary Metabolism

(None)

Expression data

Analysis 1: Expression analysis during behavioral modification. Published in: Will et al., G3, 2020

Click here for more information

Orthologs

Orthofinder run ID4
Orthogroup2837
Change Orthofinder run
Species Protein ID
Ophiocordyceps australis 1348a (Ghana) OphauG2|685
Ophiocordyceps australis map64 (Brazil) OphauB2|5393
Ophiocordyceps camponoti-floridani Ophcf2|00761 (this protein)
Ophiocordyceps camponoti-rufipedis Ophun1|1365
Ophiocordyceps kimflemingae Ophio5|4459
Ophiocordyceps subramaniannii Hirsu2|4632

Sequences

Type of sequenceSequence
Locus Download genbank file of locus Download genbank file of locus (reverse complement)
The gene with 5 kb flanks (if sufficient flanking sequence is available). For use in cloning design programs. NOTE: features (genes or exons) that are only partially contained within the sequence are completely excluded.
Protein >Ophcf2|00761
MACREILSSRTETVNKYMKLDQKGSIMAEYVWIDADGEVRSKSRTLPEKKYKPEDLATWNFDGSSTSQAPGGNSD
VYLRPCAVFADPFRGAPNIIVLSECWNADGTPNKYNYRHECDKVMKTYASHVPWFGLEQEYTFLGHDDRPYGWPT
NGYPAPQGPYYCGVGSGKVVMRDVVESHYKACLYAGVKISGTNAEVMPGQWEFQVGPCEGIEMGDHLWIARFFLA
RVAEDFGVKVSWHPKPIRGDWNGAGLHSNFSTKEMRSEGGMKFIEDALKKLEPHHMDCIKEYGEDNEQRLTGQHE
TGSIEKFTYGVANRGTSIRIPRETAAKGCGYFEDRRPASNADPYRVSKVLMTSIFGKP*
Coding >Ophcf2|00761
ATGGCTTGTCGCGAAATCCTCTCGTCTCGGACCGAGACGGTCAACAAGTACATGAAGCTCGATCAGAAGGGCTCC
ATCATGGCCGAGTACGTCTGGATCGATGCCGACGGCGAGGTCCGCTCCAAGTCCCGGACTCTCCCCGAGAAGAAA
TACAAGCCCGAGGACCTGGCCACCTGGAACTTTGACGGCTCCTCCACCAGTCAGGCCCCCGGTGGAAACTCGGAC
GTCTACCTCCGACCCTGCGCCGTCTTCGCCGACCCTTTCCGCGGCGCGCCCAACATCATCGTTCTGTCCGAGTGC
TGGAACGCAGATGGAACGCCCAACAAGTACAACTATCGCCACGAGTGCGACAAGGTCATGAAGACGTACGCCAGC
CATGTGCCTTGGTTCGGTCTCGAGCAAGAATACACCTTCCTCGGCCACGATGACCGTCCCTACGGCTGGCCTACC
AACGGCTACCCTGCCCCTCAAGGACCCTATTATTGTGGTGTCGGCAGCGGGAAAGTCGTCATGCGCGATGTCGTC
GAGTCGCACTACAAAGCTTGCCTGTATGCCGGGGTCAAGATTTCGGGAACCAACGCCGAGGTGATGCCTGGGCAG
TGGGAGTTCCAGGTCGGACCCTGCGAGGGCATTGAAATGGGCGATCATCTCTGGATTGCCCGTTTCTTCCTGGCC
CGAGTTGCTGAAGATTTTGGCGTCAAGGTCTCGTGGCACCCGAAGCCGATCCGCGGCGACTGGAACGGCGCCGGT
CTTCACTCCAACTTTTCCACCAAAGAGATGCGCAGCGAGGGCGGCATGAAGTTCATAGAGGACGCTCTCAAGAAG
CTGGAGCCGCATCACATGGACTGCATCAAGGAATACGGCGAGGATAACGAGCAGCGTCTCACGGGTCAGCACGAG
ACGGGATCCATCGAAAAGTTCACGTACGGAGTCGCCAACCGCGGCACTTCTATCCGCATTCCGCGCGAGACGGCC
GCCAAGGGCTGCGGCTACTTCGAGGATCGACGTCCTGCCTCCAACGCGGATCCTTACCGCGTCAGCAAGGTGCTC
ATGACTTCCATCTTTGGCAAGCCATAA
Transcript >Ophcf2|00761
ATGGCTTGTCGCGAAATCCTCTCGTCTCGGACCGAGACGGTCAACAAGTACATGAAGCTCGATCAGAAGGGCTCC
ATCATGGCCGAGTACGTCTGGATCGATGCCGACGGCGAGGTCCGCTCCAAGTCCCGGACTCTCCCCGAGAAGAAA
TACAAGCCCGAGGACCTGGCCACCTGGAACTTTGACGGCTCCTCCACCAGTCAGGCCCCCGGTGGAAACTCGGAC
GTCTACCTCCGACCCTGCGCCGTCTTCGCCGACCCTTTCCGCGGCGCGCCCAACATCATCGTTCTGTCCGAGTGC
TGGAACGCAGATGGAACGCCCAACAAGTACAACTATCGCCACGAGTGCGACAAGGTCATGAAGACGTACGCCAGC
CATGTGCCTTGGTTCGGTCTCGAGCAAGAATACACCTTCCTCGGCCACGATGACCGTCCCTACGGCTGGCCTACC
AACGGCTACCCTGCCCCTCAAGGACCCTATTATTGTGGTGTCGGCAGCGGGAAAGTCGTCATGCGCGATGTCGTC
GAGTCGCACTACAAAGCTTGCCTGTATGCCGGGGTCAAGATTTCGGGAACCAACGCCGAGGTGATGCCTGGGCAG
TGGGAGTTCCAGGTCGGACCCTGCGAGGGCATTGAAATGGGCGATCATCTCTGGATTGCCCGTTTCTTCCTGGCC
CGAGTTGCTGAAGATTTTGGCGTCAAGGTCTCGTGGCACCCGAAGCCGATCCGCGGCGACTGGAACGGCGCCGGT
CTTCACTCCAACTTTTCCACCAAAGAGATGCGCAGCGAGGGCGGCATGAAGTTCATAGAGGACGCTCTCAAGAAG
CTGGAGCCGCATCACATGGACTGCATCAAGGAATACGGCGAGGATAACGAGCAGCGTCTCACGGGTCAGCACGAG
ACGGGATCCATCGAAAAGTTCACGTACGGAGTCGCCAACCGCGGCACTTCTATCCGCATTCCGCGCGAGACGGCC
GCCAAGGGCTGCGGCTACTTCGAGGATCGACGTCCTGCCTCCAACGCGGATCCTTACCGCGTCAGCAAGGTGCTC
ATGACTTCCATCTTTGGCAAGCCATAA
Gene >Ophcf2|00761
ATGGTCAGTCATCGTCGGGGTTCACGTCTGCCTCGGTTGCTTCTCTTTGCTGACCCGTGTTTGCTCGCTCGCAGG
CTTGTCGCGAAATCCTCTCGTCTCGGACCGAGACGGTACGTGCCCCGGATAGAAAATGCCGTCGACGAGGCTGAT
GGTCCTTCTCTGCAGGTCAACAAGTACATGAAGCTCGATCAGAAGGGCTCCATCATGGCCGAGTACGTCTGGATC
GATGCCGACGGCGAGGTCCGCTCCAAGTCCCGGGTAAGCCTGCCTCCTTTCTCGCCAGAGGATGCCGCTGCTGCA
TGCAGTTGCTTTTGCAGCGCCATCCGAGGCAGACGTACGCTGCTGACACCGCCTCTTGCTAGACTCTCCCCGAGA
AGAAATACAAGCCCGAGGACCTGGCCACCTGGAACTTTGACGGCTCCTCCACCAGTCAGGCCCCCGGTGGAAACT
CGGACGTCTACCTCCGACCCTGCGCCGTCTTCGCCGACCCTTTCCGCGGCGCGCCCAACATCATCGTTCTGTCCG
AGTGCTGGAACGCAGATGGAACGCCCAACAAGTACAACTATCGCCACGAGTGCGACAAGGTCATGAAGACGTACG
CCAGCCATGTGCCTTGGTTCGGTCTCGAGCAAGAATACACCTTCCTCGGCCACGATGACCGTCCCTACGGCTGGC
CTACCAACGGCTACCCTGCCCCGTAAGCCGCATCGTCACCATGCATTAGTTCTCTTGTGCTGACCCCCCCCTGTT
TAGTCAAGGACCCTATTATTGTGGTGTCGGCAGCGGGAAAGTCGTCATGCGCGATGTCGTCGAGTCGCACTACAA
AGCTTGCCTGTGTAAGTAGGCCTGGACGTCGACACTCGACTCCGTACTGACCCGAAGGGGGTGCGAACCAGATGC
CGGGGTCAAGATTTCGGGAACCAACGCCGAGGTGATGCCTGGGCAGTGGGAGTTCCAGGTCGGACCCTGCGAGGG
CATTGAAAGTACGTCATCAGCGTCCCACCGCCACCACCACGATCACGAACCCCATAAGGCAATGCTGACGTCAAT
CTGCAGTGGGCGATCATCTCTGGATTGCCCGTTTCTTCCTGGCCCGAGTTGCTGAAGATTTTGGCGTCAAGGTCT
CGTGGCACCCGAAGCCGATCCGCGGCGACTGGAACGGCGCCGGTCTTCACTCCAACTTTTCCACCAAAGAGATGC
GCAGCGAGGGCGGCATGAAGTTCATAGAGGACGCTCTCAAGAAGCTGGAGCCGCATCACATGGACTGCATCAAGG
AATACGGCGAGGATAACGAGCAGCGTCTCACGGGTCAGCACGAGACGGGATCCATCGAAAAGTTCACGTACGGAG
TCGCCAACCGCGGCACTTCTATCCGCATTCCGCGCGAGACGGCCGCCAAGGGCTGCGGCTACTTCGAGGATCGAC
GTCCTGCCTCCAACGCGGATCCTTACCGCGTCAGCAAGGTGCTCATGACTTCCATCTTTGGCAAGCCATAA

© 2023 - Robin Ohm - Utrecht University - The Netherlands

Built with Python Django and Wagtail