Fungal Genomics

at Utrecht University

General Properties

Protein IDOphcf2|00758
Gene name
Locationscaffold_01:2883182..2884964
Strand-
Gene length (bp)1782
Transcript length (bp)1443
Coding sequence length (bp)1443
Protein length (aa) 481

Your browser does not support drawing a protein figure.

PFAM Domains

PFAM Domain ID Short name Long name E-value Start End
PF07690 MFS_1 Major Facilitator Superfamily 4.1E-28 93 378
PF07690 MFS_1 Major Facilitator Superfamily 2.9E-14 333 465

GO

GO Term Description Terminal node
GO:0022857 transmembrane transporter activity Yes
GO:0055085 transmembrane transport Yes
GO:0051179 localization No
GO:0008150 biological_process No
GO:0006810 transport No
GO:0009987 cellular process No
GO:0003674 molecular_function No
GO:0005215 transporter activity No
GO:0051234 establishment of localization No

SignalP

[Help with interpreting these statistics]
SignalP signal predicted Location
(based on Ymax)
D score
(significance: > 0.45)
No 1 - 11 0.45

Transmembrane Domains

Domain # Start End Length
1 90 112 22
2 127 149 22
3 179 201 22
4 216 238 22
5 245 267 22
6 294 316 22
7 354 376 22
8 380 402 22
9 415 434 19
10 449 471 22

Transcription Factor Class

(None)

Expression data

Analysis 1: Expression analysis during behavioral modification. Published in: Will et al., G3, 2020

Click here for more information

Sequences

Type of sequenceSequence
Locus Download genbank file of locus
The gene with 5 kb flanks (if sufficient flanking sequence is available). For use in cloning design programs. NOTE: features (genes or exons) that are only partially contained within the sequence are completely excluded.
Protein >Ophcf2|00758
MKQPPEQQTTWHEAGTGILPDSPPGDGPCEGLSTVVASEPASTSGSCFAGTQTEMQTWAETRPVLSSCGSPVKES
SETGFPDGGIRAWMVVAGGFLNFMVTFGILNSFGTFQAYYESKWPDLSTSTITWIGSVQLCLFFLGGIFIGPVFD
RYGGQKLMFIGTTFCVLSFLGASWSTRYWHYLLSQGFLLGTGSALLFYPTTGAISEWFDGKRGLALGIAVSGSSL
GGVFWPILLQVLFNKVSEEVVYRIMAVISTPLLLLSCYLIRARPGHGTAADESLNRQRTVVGTILEPRFISLSVV
LMILYAGMLIPFYYIPLYSQERGVDRVMSNHLLSISYGGSFIGRIASGWLADCLGRFNILALIGLLMSFMTLWWI
WMQSVSQMVVFAVLFGLFSAGLVPLGSACVAQTTPDMGRIGLRIGVMMAVCSIGALAGGPVSGLLRESTAGWPSV
HLFSASLSLLGALLLSAVRLWHQPRLLAKF*
Coding >Ophcf2|00758
ATGAAGCAACCCCCCGAGCAGCAGACAACGTGGCACGAAGCCGGCACCGGCATCCTCCCCGACTCCCCCCCGGGA
GACGGCCCATGCGAAGGTCTCTCCACCGTCGTTGCTTCGGAACCGGCCTCGACGTCCGGCAGTTGCTTTGCCGGC
ACGCAGACGGAGATGCAGACTTGGGCGGAGACGAGGCCTGTTCTGTCGTCGTGCGGGTCGCCTGTCAAGGAGAGC
AGCGAGACGGGGTTCCCTGATGGGGGGATTCGGGCTTGGATGGTTGTTGCCGGGGGGTTTCTCAACTTCATGGTC
ACCTTTGGTATCCTCAACTCGTTCGGCACCTTTCAAGCCTACTACGAGAGCAAGTGGCCCGATCTGAGCACTTCG
ACCATTACATGGATAGGCAGCGTCCAGCTCTGCCTCTTCTTCCTCGGCGGCATCTTCATCGGCCCCGTCTTCGAC
CGCTACGGTGGCCAGAAACTCATGTTCATCGGCACCACCTTTTGCGTCCTCTCCTTTCTCGGAGCCAGCTGGTCG
ACTCGGTACTGGCACTACCTCCTATCGCAGGGCTTCCTGCTGGGGACGGGCAGCGCCTTGCTGTTCTATCCCACC
ACCGGAGCCATCTCGGAATGGTTCGACGGCAAACGCGGCCTCGCTCTCGGCATCGCCGTCTCCGGATCCTCCCTC
GGCGGCGTCTTCTGGCCCATTCTCCTTCAAGTGCTGTTCAACAAGGTGTCGGAAGAAGTCGTCTACCGCATCATG
GCCGTCATATCGACCCCTCTTCTCCTCCTCTCCTGCTACCTCATCCGTGCCCGCCCCGGCCACGGGACAGCCGCG
GACGAGAGCCTCAACCGACAGCGAACCGTCGTCGGCACCATCCTCGAGCCTCGATTCATCTCGCTGAGCGTCGTC
CTCATGATTCTTTACGCCGGCATGCTCATCCCCTTTTACTATATTCCGCTCTACTCGCAGGAACGAGGCGTGGAC
CGCGTCATGTCCAATCACCTCCTTTCCATCTCATACGGAGGCTCCTTCATCGGCCGTATCGCATCCGGATGGCTG
GCCGATTGTCTCGGCAGGTTCAACATCCTTGCCCTCATCGGCCTCCTGATGAGCTTCATGACGCTGTGGTGGATC
TGGATGCAGTCAGTCTCGCAGATGGTCGTCTTCGCCGTCCTCTTCGGCCTCTTCTCCGCCGGTCTCGTCCCCCTC
GGCTCGGCCTGCGTGGCCCAGACGACACCGGACATGGGCCGGATCGGGCTCCGCATCGGCGTCATGATGGCCGTC
TGCTCCATCGGTGCCCTGGCCGGTGGTCCCGTCAGCGGCCTCCTCCGCGAGAGTACCGCCGGCTGGCCGTCCGTC
CACCTCTTTTCGGCCTCGCTCTCCCTGCTGGGCGCCCTGCTGCTATCCGCTGTCAGGTTGTGGCATCAGCCGCGG
CTGCTGGCAAAGTTCTGA
Transcript >Ophcf2|00758
ATGAAGCAACCCCCCGAGCAGCAGACAACGTGGCACGAAGCCGGCACCGGCATCCTCCCCGACTCCCCCCCGGGA
GACGGCCCATGCGAAGGTCTCTCCACCGTCGTTGCTTCGGAACCGGCCTCGACGTCCGGCAGTTGCTTTGCCGGC
ACGCAGACGGAGATGCAGACTTGGGCGGAGACGAGGCCTGTTCTGTCGTCGTGCGGGTCGCCTGTCAAGGAGAGC
AGCGAGACGGGGTTCCCTGATGGGGGGATTCGGGCTTGGATGGTTGTTGCCGGGGGGTTTCTCAACTTCATGGTC
ACCTTTGGTATCCTCAACTCGTTCGGCACCTTTCAAGCCTACTACGAGAGCAAGTGGCCCGATCTGAGCACTTCG
ACCATTACATGGATAGGCAGCGTCCAGCTCTGCCTCTTCTTCCTCGGCGGCATCTTCATCGGCCCCGTCTTCGAC
CGCTACGGTGGCCAGAAACTCATGTTCATCGGCACCACCTTTTGCGTCCTCTCCTTTCTCGGAGCCAGCTGGTCG
ACTCGGTACTGGCACTACCTCCTATCGCAGGGCTTCCTGCTGGGGACGGGCAGCGCCTTGCTGTTCTATCCCACC
ACCGGAGCCATCTCGGAATGGTTCGACGGCAAACGCGGCCTCGCTCTCGGCATCGCCGTCTCCGGATCCTCCCTC
GGCGGCGTCTTCTGGCCCATTCTCCTTCAAGTGCTGTTCAACAAGGTGTCGGAAGAAGTCGTCTACCGCATCATG
GCCGTCATATCGACCCCTCTTCTCCTCCTCTCCTGCTACCTCATCCGTGCCCGCCCCGGCCACGGGACAGCCGCG
GACGAGAGCCTCAACCGACAGCGAACCGTCGTCGGCACCATCCTCGAGCCTCGATTCATCTCGCTGAGCGTCGTC
CTCATGATTCTTTACGCCGGCATGCTCATCCCCTTTTACTATATTCCGCTCTACTCGCAGGAACGAGGCGTGGAC
CGCGTCATGTCCAATCACCTCCTTTCCATCTCATACGGAGGCTCCTTCATCGGCCGTATCGCATCCGGATGGCTG
GCCGATTGTCTCGGCAGGTTCAACATCCTTGCCCTCATCGGCCTCCTGATGAGCTTCATGACGCTGTGGTGGATC
TGGATGCAGTCAGTCTCGCAGATGGTCGTCTTCGCCGTCCTCTTCGGCCTCTTCTCCGCCGGTCTCGTCCCCCTC
GGCTCGGCCTGCGTGGCCCAGACGACACCGGACATGGGCCGGATCGGGCTCCGCATCGGCGTCATGATGGCCGTC
TGCTCCATCGGTGCCCTGGCCGGTGGTCCCGTCAGCGGCCTCCTCCGCGAGAGTACCGCCGGCTGGCCGTCCGTC
CACCTCTTTTCGGCCTCGCTCTCCCTGCTGGGCGCCCTGCTGCTATCCGCTGTCAGGTTGTGGCATCAGCCGCGG
CTGCTGGCAAAGTTCTGA
Gene >Ophcf2|00758
ATGAAGCAACCCCCCGAGCAGCAGACAACGTGGCACGAAGCCGGCACCGGCATCCTCCCCGACTCCCCCCCGGGA
GACGGCCCATGCGAAGGTCTCTCCACCGTCGTTGCTTCGGAACCGGCCTCGACGTCCGGCAGTTGCTTTGCCGGC
ACGCAGACGGAGATGCAGACTTGGGCGGAGACGAGGCCTGTTCTGTCGTCGTGCGGGTCGCCTGTCAAGGAGAGC
AGCGAGACGGGGTTCCCTGATGGGGGGATTCGGGCTTGGATGGTTGTTGCCGGGGGGTTTCTCAACTTCATGGTC
ACCTTTGGTGAGTTGGCCTTGTTCCTTTCCTTTCCTTTCCTTTGTTGGCTTGGAGGCTTGCTCGAGCTGATGGAT
GGCAACGTATATACACATACACACATGACAGGTATCCTCAACTCGTTCGGCACCTTTCAAGCCTACTACGAGAGC
AAGTGGCCCGATCTGAGCACTTCGACCATTACATGGATAGGCAGCGTCCAGGCAAGTCGTCCCCTTCAACTGCCA
CGTATCGAGACCCATGTTGCTGACACCATGACCCCGTAAACCAGCTCTGCCTCTTCTTCCTCGGCGGCATCTTCA
TCGGCCCCGTCTTCGACCGCTACGGTGGCCAGAAACTCATGTTCATCGGCACCACCTTTTGCGTCCTCTCCTTTC
TCGGAGCCAGCTGGTCGACTCGGTACTGGCACTACCTCCTATCGCAGGGCTTCCTGCTGGGGACGGGCAGCGCCT
TGCTGTGAGTACACACGCGGATGGCCATGCCCCGTGGCCATGTCCCGTGGCCATATCCCATGAGCCATATCCCCT
ACAACTCTCCTCCCTCGTCGACTCTCCATCTCACCTTCGACCGGCAGGTTCTATCCCACCACCGGAGCCATCTCG
GAATGGTTCGACGGCAAACGCGGCCTCGCTCTCGGCATCGCCGTCTCCGGATCCTCCCTCGGCGGCGTCTTCTGG
CCCATTCTCCTTCAAGTGCTGTTCAACAAGGTGTCGGAAGAAGTCGTCTACCGCATCATGGCCGTCATATCGACC
CCTCTTCTCCTCCTCTCCTGCTACCTCATCCGTGCCCGCCCCGGCCACGGGACAGCCGCGGACGAGAGCCTCAAC
CGACAGCGAACCGTCGTCGGCACCATCCTCGAGCCTCGATTCATCTCGCTGAGCGTCGTCCTCATGATTCTTTAC
GCCGGCATGCTCATCCCCTTTTACTATATTCCGCTCTACTCGCAGGAACGAGGCGTGGACCGCGTCATGTCCAAT
CACCTCCTTTCCATCTCATACGGAGGCTCCTTCATCGGCCGTATCGCATCCGGATGGCTGGCCGATTGTCTCGGC
AGGCAAGCAGACGGGGGAGCCCCTTTCATTCCTCACCTGGCTGACGTTATTCGCAGGTTCAACATCCTTGCCCTC
ATCGGCCTCCTGATGAGCTTCATGACGCTGTGGTGGATCTGGATGCAGTCAGTCTCGCAGATGGTCGTCTTCGCC
GTCCTCTTCGGCCTCTTCTCCGCCGGTCTCGTCCCCCTCGGCTCGGCCTGCGTGGCCCAGACGACACCGGACATG
GGCCGGATCGGGCTCCGCATCGGCGTCATGATGGCCGTCTGCTCCATCGGTGCCCTGGCCGGTGGTCCCGTCAGC
GGCCTCCTCCGCGAGAGTACCGCCGGCTGGCCGTCCGTCCACCTCTTTTCGGCCTCGCTCTCCCTGCTGGGCGCC
CTGCTGCTATCCGCTGTCAGGTTGTGGCATCAGCCGCGGCTGCTGGCAAAGTTCTGA

© 2022 - Robin Ohm - Utrecht University - The Netherlands

Built with Python Django and Wagtail