Fungal Genomics

at Utrecht University

General Properties

Protein IDOphcf2|00757
Gene name
Locationscaffold_01:2880984..2882379
Strand+
Gene length (bp)1395
Transcript length (bp)1395
Coding sequence length (bp)1395
Protein length (aa) 465

Overview

Your browser does not support drawing a protein figure.

PFAM Domains

PFAM Domain ID Short name Long name E-value Start End
PF05004 IFRD Interferon-related developmental regulator (IFRD) 4.8E-55 82 355

GO

(None)

Deeploc

[Help with interpreting the results of Deeploc 2.0]
Localizations Signals Cytoplasm Nucleus Extracellular Cell membrane Mitochondrion Plastid Endoplasmic reticulum Lysosome vacuole Golgi apparatus Peroxisome
Cytoplasm|Nucleus Nuclear localization signal 0.5675 0.7767 0.0219 0.0825 0.078 0.0059 0.07 0.0313 0.0916 0.0021

SignalP

(None)

Transmembrane Domains

(None)

Transcription Factor Class

(None)

CAZymes

(None)

Secondary Metabolism

(None)

Expression data

Analysis 1: Expression analysis during behavioral modification. Published in: Will et al., G3, 2020

Click here for more information

Orthologs

Orthofinder run ID4
Orthogroup3854
Change Orthofinder run
Species Protein ID
Ophiocordyceps australis 1348a (Ghana) OphauG2|5091
Ophiocordyceps australis map64 (Brazil) OphauB2|146
Ophiocordyceps camponoti-floridani Ophcf2|00757 (this protein)
Ophiocordyceps camponoti-rufipedis Ophun1|1653
Ophiocordyceps kimflemingae Ophio5|7376
Ophiocordyceps subramaniannii Hirsu2|763

Sequences

Type of sequenceSequence
Locus Download genbank file of locus Download genbank file of locus (reverse complement)
The gene with 5 kb flanks (if sufficient flanking sequence is available). For use in cloning design programs. NOTE: features (genes or exons) that are only partially contained within the sequence are completely excluded.
Protein >Ophcf2|00757
MNHARVKALKGNGKTVSKKAQKSGRASGTLTPQGSSSPLHASPSHSNTPSRVASDVSDNEEDGDLDFDDMTSSVH
SGGSGPEVADDTASGFDVQALIDGLTDRKRNNSSVREQYLDAYLRVLRKRYNVQVHLWLDPAAAALVDMFLKDAN
RGATPRERLLSLQAYALTLAVVEDLDVYEVGSKLLKQILTDEDDQDCRVQAIYALCMTTLYGGGLQEVALELMQY
LVEIVQSDGESIEAHDDVAVVSAAMRGWAFVASHVDDYADDADSAMDAFVDQLDSADVEVQSLAGHCIALIYESS
RTHETETGEPFQLPYDPQRLVCRLEELAKLSAKSVSRKNRRDLRDSLVSVVTSLERGVGPYYSTALYVPEPDAFV
PASLRTDDGRAEYGHRCKLRLGGRTALIDTWSLYSRVNMMKLLFQGGLENHVFVNPVVVECLEDAEWDEALAIAE
PERKPRLSAKARKR*
Coding >Ophcf2|00757
ATGAATCACGCTCGAGTAAAAGCCCTCAAGGGCAACGGCAAGACGGTGTCGAAGAAGGCACAGAAATCTGGTCGA
GCATCGGGCACTCTGACGCCTCAGGGCTCCTCCTCGCCTCTTCACGCCTCGCCCTCTCACTCCAACACGCCCAGC
CGCGTCGCTTCTGATGTCAGCGATAACGAGGAGGATGGAGACCTCGACTTTGACGATATGACTTCCAGCGTCCAT
TCCGGAGGCTCGGGGCCTGAAGTGGCTGACGACACTGCTTCCGGATTCGACGTTCAGGCTCTCATCGATGGCCTC
ACGGACCGCAAACGCAACAATAGCAGCGTCCGCGAGCAGTATCTCGACGCCTATCTCCGCGTTCTTCGGAAGCGA
TACAATGTTCAAGTCCATCTCTGGCTGGATCCGGCCGCCGCCGCCCTCGTCGACATGTTCCTCAAGGACGCGAAT
CGAGGGGCCACGCCCAGGGAGCGCTTGCTCAGTTTGCAGGCCTACGCCCTGACCCTGGCCGTCGTCGAGGACCTG
GACGTGTACGAGGTCGGAAGCAAGCTCCTGAAGCAGATTTTGACCGACGAGGATGATCAAGACTGCCGAGTCCAA
GCCATCTACGCCTTGTGCATGACGACGCTCTACGGAGGAGGTCTCCAGGAGGTTGCCCTCGAGCTCATGCAGTAT
CTCGTCGAGATCGTGCAGTCGGACGGCGAGAGCATCGAGGCTCACGACGACGTGGCAGTCGTCTCTGCCGCCATG
AGAGGTTGGGCCTTTGTCGCCAGCCACGTCGACGACTATGCAGACGACGCCGACTCGGCTATGGATGCGTTTGTC
GACCAGCTAGATAGCGCCGACGTCGAAGTCCAGTCGCTGGCTGGTCACTGCATCGCCCTCATCTACGAGTCGTCG
CGCACGCACGAGACGGAGACTGGAGAGCCCTTTCAGCTGCCATATGATCCGCAGAGGCTCGTCTGCCGGCTCGAG
GAGCTCGCCAAGCTGAGCGCCAAATCCGTCTCTCGCAAGAACCGGCGTGATCTTCGCGACAGCCTCGTCAGCGTC
GTCACGTCGCTCGAGAGGGGCGTCGGCCCTTACTACTCGACGGCCCTCTACGTCCCGGAACCGGACGCCTTCGTG
CCGGCCTCGCTGCGGACCGACGACGGCAGGGCCGAATACGGCCATCGATGCAAGCTGCGGCTCGGCGGGCGCACC
GCCCTCATCGACACGTGGTCTCTGTACTCGAGAGTCAACATGATGAAGCTGCTCTTCCAGGGGGGGCTCGAGAAC
CACGTGTTTGTCAACCCGGTCGTGGTCGAGTGCTTGGAGGACGCCGAGTGGGATGAGGCGCTGGCGATTGCCGAG
CCGGAGCGGAAACCGAGACTTTCAGCCAAGGCTCGCAAGAGATGA
Transcript >Ophcf2|00757
ATGAATCACGCTCGAGTAAAAGCCCTCAAGGGCAACGGCAAGACGGTGTCGAAGAAGGCACAGAAATCTGGTCGA
GCATCGGGCACTCTGACGCCTCAGGGCTCCTCCTCGCCTCTTCACGCCTCGCCCTCTCACTCCAACACGCCCAGC
CGCGTCGCTTCTGATGTCAGCGATAACGAGGAGGATGGAGACCTCGACTTTGACGATATGACTTCCAGCGTCCAT
TCCGGAGGCTCGGGGCCTGAAGTGGCTGACGACACTGCTTCCGGATTCGACGTTCAGGCTCTCATCGATGGCCTC
ACGGACCGCAAACGCAACAATAGCAGCGTCCGCGAGCAGTATCTCGACGCCTATCTCCGCGTTCTTCGGAAGCGA
TACAATGTTCAAGTCCATCTCTGGCTGGATCCGGCCGCCGCCGCCCTCGTCGACATGTTCCTCAAGGACGCGAAT
CGAGGGGCCACGCCCAGGGAGCGCTTGCTCAGTTTGCAGGCCTACGCCCTGACCCTGGCCGTCGTCGAGGACCTG
GACGTGTACGAGGTCGGAAGCAAGCTCCTGAAGCAGATTTTGACCGACGAGGATGATCAAGACTGCCGAGTCCAA
GCCATCTACGCCTTGTGCATGACGACGCTCTACGGAGGAGGTCTCCAGGAGGTTGCCCTCGAGCTCATGCAGTAT
CTCGTCGAGATCGTGCAGTCGGACGGCGAGAGCATCGAGGCTCACGACGACGTGGCAGTCGTCTCTGCCGCCATG
AGAGGTTGGGCCTTTGTCGCCAGCCACGTCGACGACTATGCAGACGACGCCGACTCGGCTATGGATGCGTTTGTC
GACCAGCTAGATAGCGCCGACGTCGAAGTCCAGTCGCTGGCTGGTCACTGCATCGCCCTCATCTACGAGTCGTCG
CGCACGCACGAGACGGAGACTGGAGAGCCCTTTCAGCTGCCATATGATCCGCAGAGGCTCGTCTGCCGGCTCGAG
GAGCTCGCCAAGCTGAGCGCCAAATCCGTCTCTCGCAAGAACCGGCGTGATCTTCGCGACAGCCTCGTCAGCGTC
GTCACGTCGCTCGAGAGGGGCGTCGGCCCTTACTACTCGACGGCCCTCTACGTCCCGGAACCGGACGCCTTCGTG
CCGGCCTCGCTGCGGACCGACGACGGCAGGGCCGAATACGGCCATCGATGCAAGCTGCGGCTCGGCGGGCGCACC
GCCCTCATCGACACGTGGTCTCTGTACTCGAGAGTCAACATGATGAAGCTGCTCTTCCAGGGGGGGCTCGAGAAC
CACGTGTTTGTCAACCCGGTCGTGGTCGAGTGCTTGGAGGACGCCGAGTGGGATGAGGCGCTGGCGATTGCCGAG
CCGGAGCGGAAACCGAGACTTTCAGCCAAGGCTCGCAAGAGATGA
Gene >Ophcf2|00757
ATGAATCACGCTCGAGTAAAAGCCCTCAAGGGCAACGGCAAGACGGTGTCGAAGAAGGCACAGAAATCTGGTCGA
GCATCGGGCACTCTGACGCCTCAGGGCTCCTCCTCGCCTCTTCACGCCTCGCCCTCTCACTCCAACACGCCCAGC
CGCGTCGCTTCTGATGTCAGCGATAACGAGGAGGATGGAGACCTCGACTTTGACGATATGACTTCCAGCGTCCAT
TCCGGAGGCTCGGGGCCTGAAGTGGCTGACGACACTGCTTCCGGATTCGACGTTCAGGCTCTCATCGATGGCCTC
ACGGACCGCAAACGCAACAATAGCAGCGTCCGCGAGCAGTATCTCGACGCCTATCTCCGCGTTCTTCGGAAGCGA
TACAATGTTCAAGTCCATCTCTGGCTGGATCCGGCCGCCGCCGCCCTCGTCGACATGTTCCTCAAGGACGCGAAT
CGAGGGGCCACGCCCAGGGAGCGCTTGCTCAGTTTGCAGGCCTACGCCCTGACCCTGGCCGTCGTCGAGGACCTG
GACGTGTACGAGGTCGGAAGCAAGCTCCTGAAGCAGATTTTGACCGACGAGGATGATCAAGACTGCCGAGTCCAA
GCCATCTACGCCTTGTGCATGACGACGCTCTACGGAGGAGGTCTCCAGGAGGTTGCCCTCGAGCTCATGCAGTAT
CTCGTCGAGATCGTGCAGTCGGACGGCGAGAGCATCGAGGCTCACGACGACGTGGCAGTCGTCTCTGCCGCCATG
AGAGGTTGGGCCTTTGTCGCCAGCCACGTCGACGACTATGCAGACGACGCCGACTCGGCTATGGATGCGTTTGTC
GACCAGCTAGATAGCGCCGACGTCGAAGTCCAGTCGCTGGCTGGTCACTGCATCGCCCTCATCTACGAGTCGTCG
CGCACGCACGAGACGGAGACTGGAGAGCCCTTTCAGCTGCCATATGATCCGCAGAGGCTCGTCTGCCGGCTCGAG
GAGCTCGCCAAGCTGAGCGCCAAATCCGTCTCTCGCAAGAACCGGCGTGATCTTCGCGACAGCCTCGTCAGCGTC
GTCACGTCGCTCGAGAGGGGCGTCGGCCCTTACTACTCGACGGCCCTCTACGTCCCGGAACCGGACGCCTTCGTG
CCGGCCTCGCTGCGGACCGACGACGGCAGGGCCGAATACGGCCATCGATGCAAGCTGCGGCTCGGCGGGCGCACC
GCCCTCATCGACACGTGGTCTCTGTACTCGAGAGTCAACATGATGAAGCTGCTCTTCCAGGGGGGGCTCGAGAAC
CACGTGTTTGTCAACCCGGTCGTGGTCGAGTGCTTGGAGGACGCCGAGTGGGATGAGGCGCTGGCGATTGCCGAG
CCGGAGCGGAAACCGAGACTTTCAGCCAAGGCTCGCAAGAGATGA

© 2023 - Robin Ohm - Utrecht University - The Netherlands

Built with Python Django and Wagtail