Fungal Genomics

at Utrecht University

General Properties

Protein IDOphcf2|00749
Gene name
Locationscaffold_01:2867045..2867691
Strand-
Gene length (bp)646
Transcript length (bp)597
Coding sequence length (bp)597
Protein length (aa) 199

Your browser does not support drawing a protein figure.

PFAM Domains

(None)

GO

(None)

SignalP

[Help with interpreting these statistics]
SignalP signal predicted Location
(based on Ymax)
D score
(significance: > 0.45)
No 1 - 18 0.5

Transmembrane Domains

Domain # Start End Length
1 5 27 22
2 84 106 22
3 118 140 22
4 155 177 22

Transcription Factor Class

(None)

Expression data

Analysis 1: Expression analysis during behavioral modification. Published in: Will et al., G3, 2020

Expression values

Label Description Expression (RPKM) Confidence interval (low) Confidence interval (high)
Fungus Fungus in pure culture 129.77 71.79 187.76
Alive In ants, during behavior modification 105.63 55.81 155.44
Dead In ants, recently dead 100.48 53.53 147.44

Differential expression

Label1 Label2 Q-value Significant difference
Alive Fungus 0.343962 no
Alive Dead 0.822672 no
Dead Fungus 0.219641 no

Sequences

Type of sequenceSequence
Locus Download genbank file of locus
The gene with 5 kb flanks (if sufficient flanking sequence is available). For use in cloning design programs. NOTE: features (genes or exons) that are only partially contained within the sequence are completely excluded.
Protein >Ophcf2|00749
MTRVSIYASALAAFVAATAMLVASIAAPNWIVYAVTTAKGDHVGKTIGLNRSCSDLSTPRCREYPPAEMCENGAR
YFCSLWRTIGFMASLSTILCLACLTSFFVVLRGGKFKRETGWVFVAGMLTVVAVFELVLISMVAYLFDHDEQFGV
PGWHLGVSWYLATFSAVVCVLSAAGLVASAYLMPPEGGYESVPDPDDG*
Coding >Ophcf2|00749
ATGACGCGCGTTTCCATCTACGCCTCTGCCCTCGCTGCCTTTGTGGCCGCGACGGCCATGCTCGTTGCTTCTATC
GCAGCACCCAACTGGATTGTCTACGCTGTCACGACGGCCAAGGGCGATCATGTCGGCAAGACGATTGGGTTGAAC
AGGAGCTGCTCCGATCTCAGCACGCCGCGTTGTCGCGAGTACCCCCCGGCCGAGATGTGCGAAAACGGAGCTCGA
TATTTTTGCTCGTTGTGGCGCACCATCGGCTTCATGGCTTCGCTGTCGACCATCCTGTGTCTTGCTTGCCTGACG
AGCTTCTTCGTTGTGCTGCGGGGCGGCAAGTTTAAGCGCGAGACGGGCTGGGTGTTTGTTGCTGGCATGTTGACT
GTCGTGGCTGTCTTTGAGTTGGTGCTCATCTCCATGGTTGCCTATCTGTTTGACCACGATGAGCAGTTTGGTGTT
CCGGGTTGGCATCTTGGTGTTTCGTGGTATCTTGCTACCTTTAGCGCTGTGGTTTGCGTCCTCTCTGCTGCTGGG
CTGGTGGCTTCGGCGTATCTGATGCCGCCTGAGGGGGGTTACGAATCGGTGCCGGATCCTGACGACGGCTGA
Transcript >Ophcf2|00749
ATGACGCGCGTTTCCATCTACGCCTCTGCCCTCGCTGCCTTTGTGGCCGCGACGGCCATGCTCGTTGCTTCTATC
GCAGCACCCAACTGGATTGTCTACGCTGTCACGACGGCCAAGGGCGATCATGTCGGCAAGACGATTGGGTTGAAC
AGGAGCTGCTCCGATCTCAGCACGCCGCGTTGTCGCGAGTACCCCCCGGCCGAGATGTGCGAAAACGGAGCTCGA
TATTTTTGCTCGTTGTGGCGCACCATCGGCTTCATGGCTTCGCTGTCGACCATCCTGTGTCTTGCTTGCCTGACG
AGCTTCTTCGTTGTGCTGCGGGGCGGCAAGTTTAAGCGCGAGACGGGCTGGGTGTTTGTTGCTGGCATGTTGACT
GTCGTGGCTGTCTTTGAGTTGGTGCTCATCTCCATGGTTGCCTATCTGTTTGACCACGATGAGCAGTTTGGTGTT
CCGGGTTGGCATCTTGGTGTTTCGTGGTATCTTGCTACCTTTAGCGCTGTGGTTTGCGTCCTCTCTGCTGCTGGG
CTGGTGGCTTCGGCGTATCTGATGCCGCCTGAGGGGGGTTACGAATCGGTGCCGGATCCTGACGACGGCTGA
Gene >Ophcf2|00749
ATGACGCGCGTTTCCATCTACGCCTCTGCCCTCGCTGCCTTTGTGGCCGGTTCGTCTTCTCCCGCCTTGACCGAG
AAGTAGCTAGCTGACGAAAGCAGCGACGGCCATGCTCGTTGCTTCTATCGCAGCACCCAACTGGATTGTCTACGC
TGTCACGACGGCCAAGGGCGATCATGTCGGCAAGACGATTGGGTTGAACAGGAGCTGCTCCGATCTCAGCACGCC
GCGTTGTCGCGAGTACCCCCCGGCCGAGATGTGCGAAAACGGAGCTCGATATTTTTGCTCGTTGTGGCGCACCAT
CGGCTTCATGGCTTCGCTGTCGACCATCCTGTGTCTTGCTTGCCTGACGAGCTTCTTCGTTGTGCTGCGGGGCGG
CAAGTTTAAGCGCGAGACGGGCTGGGTGTTTGTTGCTGGCATGTTGACTGTCGTGGCTGTCTTTGAGTTGGTGCT
CATCTCCATGGTTGCCTATCTGTTTGACCACGATGAGCAGTTTGGTGTTCCGGGTTGGCATCTTGGTGTTTCGTG
GTATCTTGCTACCTTTAGCGCTGTGGTTTGCGTCCTCTCTGCTGCTGGGCTGGTGGCTTCGGCGTATCTGATGCC
GCCTGAGGGGGGTTACGAATCGGTGCCGGATCCTGACGACGGCTGA

© 2022 - Robin Ohm - Utrecht University - The Netherlands

Built with Python Django and Wagtail