Fungal Genomics

at Utrecht University

General Properties

Protein IDOphcf2|00746
Gene name
Locationscaffold_01:2842888..2848267
Strand-
Gene length (bp)5379
Transcript length (bp)3462
Coding sequence length (bp)3462
Protein length (aa) 1154

Overview

Your browser does not support drawing a protein figure.

PFAM Domains

PFAM Domain ID Short name Long name E-value Start End
PF00503 G-alpha G-protein alpha subunit 6.9E-109 15 344
PF01915 Glyco_hydro_3_C Glycosyl hydrolase family 3 C-terminal domain 2.6E-38 748 1019
PF00933 Glyco_hydro_3 Glycosyl hydrolase family 3 N terminal domain 2.1E-23 458 663
PF14310 Fn3-like Fibronectin type III-like domain 4.2E-23 1074 1142
PF00025 Arf ADP-ribosylation factor family 4.3E-08 180 276

GO

GO Term Description Terminal node
GO:0004553 hydrolase activity, hydrolyzing O-glycosyl compounds Yes
GO:0007186 G protein-coupled receptor signaling pathway Yes
GO:0005525 GTP binding Yes
GO:0003924 GTPase activity Yes
GO:0019001 guanyl nucleotide binding Yes
GO:0005975 carbohydrate metabolic process Yes
GO:0031683 G-protein beta/gamma-subunit complex binding Yes
GO:0044238 primary metabolic process No
GO:0097159 organic cyclic compound binding No
GO:0044877 protein-containing complex binding No
GO:0003824 catalytic activity No
GO:0016818 hydrolase activity, acting on acid anhydrides, in phosphorus-containing anhydrides No
GO:1901265 nucleoside phosphate binding No
GO:0017111 nucleoside-triphosphatase activity No
GO:0005488 binding No
GO:0008152 metabolic process No
GO:1901363 heterocyclic compound binding No
GO:0043168 anion binding No
GO:0050789 regulation of biological process No
GO:0009987 cellular process No
GO:0050794 regulation of cellular process No
GO:0071704 organic substance metabolic process No
GO:0065007 biological regulation No
GO:0035639 purine ribonucleoside triphosphate binding No
GO:0097367 carbohydrate derivative binding No
GO:0008150 biological_process No
GO:0043167 ion binding No
GO:0016798 hydrolase activity, acting on glycosyl bonds No
GO:0032561 guanyl ribonucleotide binding No
GO:0036094 small molecule binding No
GO:0016462 pyrophosphatase activity No
GO:0016817 hydrolase activity, acting on acid anhydrides No
GO:0000166 nucleotide binding No
GO:0007165 signal transduction No
GO:0032555 purine ribonucleotide binding No
GO:0017076 purine nucleotide binding No
GO:0032553 ribonucleotide binding No
GO:0003674 molecular_function No
GO:0016787 hydrolase activity No

Deeploc

[Help with interpreting the results of Deeploc 2.0]
Localizations Signals Cytoplasm Nucleus Extracellular Cell membrane Mitochondrion Plastid Endoplasmic reticulum Lysosome vacuole Golgi apparatus Peroxisome
Extracellular Signal peptide 0.3672 0.0817 0.788 0.1682 0.1037 0.1104 0.4595 0.4385 0.2184 0.0127

SignalP

(None)

Transmembrane Domains

(None)

Transcription Factor Class

(None)

CAZymes

CAZyme category E-value Start End
GH3 4.7E-50 476 665

Secondary Metabolism

(None)

Expression data

Analysis 1: Expression analysis during behavioral modification. Published in: Will et al., G3, 2020

Click here for more information

Orthologs

Orthofinder run ID4
Orthogroup67
Change Orthofinder run
Species Protein ID
Ophiocordyceps australis 1348a (Ghana) OphauG2|1031
Ophiocordyceps australis 1348a (Ghana) OphauG2|1889
Ophiocordyceps australis 1348a (Ghana) OphauG2|6876
Ophiocordyceps australis 1348a (Ghana) OphauG2|89
Ophiocordyceps australis map64 (Brazil) OphauB2|163
Ophiocordyceps australis map64 (Brazil) OphauB2|1634
Ophiocordyceps australis map64 (Brazil) OphauB2|3785
Ophiocordyceps camponoti-floridani Ophcf2|00746 (this protein)
Ophiocordyceps camponoti-floridani Ophcf2|04779
Ophiocordyceps camponoti-rufipedis Ophun1|1641
Ophiocordyceps camponoti-rufipedis Ophun1|38
Ophiocordyceps kimflemingae Ophio5|272
Ophiocordyceps kimflemingae Ophio5|841
Ophiocordyceps subramaniannii Hirsu2|10976
Ophiocordyceps subramaniannii Hirsu2|937

Sequences

Type of sequenceSequence
Locus Download genbank file of locus Download genbank file of locus (reverse complement)
The gene with 5 kb flanks (if sufficient flanking sequence is available). For use in cloning design programs. NOTE: features (genes or exons) that are only partially contained within the sequence are completely excluded.
Protein >Ophcf2|00746
MCFCLRSKGSNELARSRDIDRALRQDEKRKSREVKLLLLGAGESGKSTILKQMKLIYSQGFSKHERLEWKNIIFG
NIIQSFRTISEAMTEMGLQYDKPDHEKYMAHILVEPEISLHESLPRDYMEPIKALWKDSGVRAAIAKGNEYALHD
NLAYFLQDIDRIWAEGYVPSDQDLLRSRLRTTGITETEFDLGQLTYRMFDVGGQRSERKKWIHCFENVTCLMFLV
AISGYDQCLVEDKAGNQMNEALMLWESIINSFWFKKSAMILFLNKIDLFKEKLAHNPITKHGFTDYQGAPDDWNA
ASKYFLEKFRNQSRNPDKEIYCHLTNATDTNLLKITMGSVQDLIIQRNLKTLILDADMDKNIETREPPAEKELLG
PNPKQSTSSPISTMMAMILGPLLLAASVLALLAAGAAPKDDGFFYGRSPPVYPSPAMTGGEWTEAYELARSLVAQ
MTLMEKVKLTGGVKLGTGCSGSVMPVARLGFPGMCFSDAGNGLRATDFVNAYPSGIHVGASWNKGLARRRASAMA
AEFRRKGVNVLLGPVVGPVGRVVGGGRNWEAFSVDPYLSGVLVAETVEGIQGEGVQASVKHYVANEQEDYRSPET
GREAISSNVDDRTMHELYLWAFQDAVKAGCANIMCSYQRINNSYGCANSKTLNGLLKTELGFQHAGVATALAGLD
LAMPSGAEFWGEHLLEAVRNGLMTTWFQFRQNDSFPNPGFGMPEKLLGPHTPVEGRDDSSRQILLDGALEGHVLV
KNTKETLPLKRPRMLSVFGYSAKSADDWGPSTDENLNNAYAYGVIPLDPEGRLASLFSWVERPATARRGTLIGGG
GSGAVTPAVFTAPFEALKVRAARDDTALMYDLVSERPGVDPASDACLVLANAWAAEGYDRPALYDNYTDGLIRAV
ADGCARTVVVLHNAGVRIVDGFIHHENVTAVIMAHLPGRDSGEALVSLLYGDANPSGKLPYTVARAESDYGPVVG
PDQPRGDYSRFPQSDFTEGTMLDYRGFDRDGKQPRFEFGFGLSYTTFALSDLTIRTEKEAHDGPLPTGTVTAGGP
SDLWDVMATVEATVTNTGSVTGAEVVQLYLGFPGDDSPVRQLRGFDKVRLRPGERRTVRFGLTRRDLSRWDVVVQ
GWRLADGGFGVFVGNSSRVFGLSGRLEL*
Coding >Ophcf2|00746
ATGTGCTTCTGCCTCCGCAGCAAGGGTTCCAACGAGCTGGCCCGCTCGCGCGACATCGACCGGGCGCTCCGTCAG
GATGAGAAGCGAAAGTCGAGGGAGGTGAAGCTGCTGCTACTCGGAGCCGGCGAATCGGGCAAATCCACCATCCTG
AAGCAGATGAAGCTCATCTACTCGCAGGGCTTCAGCAAACATGAGCGACTCGAGTGGAAGAACATCATCTTTGGC
AACATCATTCAATCCTTCCGTACCATCTCCGAGGCCATGACGGAGATGGGCCTTCAGTACGACAAGCCCGATCAC
GAGAAATACATGGCGCACATCCTCGTCGAGCCGGAAATCAGCCTGCATGAAAGCCTCCCGCGTGATTACATGGAG
CCAATCAAGGCCCTGTGGAAGGATAGCGGCGTCAGGGCAGCCATTGCAAAGGGCAACGAATACGCGCTGCACGAC
AATCTGGCGTACTTCCTCCAAGACATCGACCGCATCTGGGCCGAGGGCTACGTCCCGAGCGACCAGGATCTCCTC
CGGTCCCGGCTCCGGACGACGGGCATCACCGAGACCGAATTCGACCTCGGGCAGCTCACCTATCGCATGTTTGAC
GTCGGTGGGCAGCGGTCGGAGCGCAAGAAGTGGATTCACTGCTTCGAGAACGTCACTTGCTTGATGTTTCTCGTC
GCCATCAGCGGCTACGATCAGTGCCTGGTCGAGGATAAAGCTGGGAACCAGATGAACGAGGCCCTCATGCTGTGG
GAGTCCATCATCAACTCGTTCTGGTTCAAGAAGTCGGCCATGATCCTCTTCCTCAACAAGATAGACCTCTTCAAA
GAGAAGCTCGCCCACAACCCCATCACCAAGCACGGCTTCACCGACTACCAGGGCGCTCCCGACGACTGGAACGCG
GCCAGCAAGTACTTCCTCGAAAAGTTCCGTAACCAGAGCCGAAACCCGGACAAGGAGATCTACTGTCATCTGACC
AACGCGACCGACACGAACCTGCTCAAGATCACCATGGGCTCTGTGCAGGACTTGATCATCCAGCGGAATCTCAAG
ACGCTGATTCTGGATGCAGACATGGACAAGAATATAGAGACGAGGGAGCCTCCAGCCGAGAAGGAGCTCTTAGGC
CCCAACCCGAAACAGTCGACATCGAGCCCGATCTCGACCATGATGGCCATGATTCTCGGTCCTCTCCTACTCGCC
GCTTCTGTTCTCGCCCTTCTGGCCGCAGGAGCCGCGCCCAAAGACGATGGCTTCTTCTACGGCCGTTCACCGCCC
GTGTATCCATCGCCGGCCATGACGGGCGGTGAATGGACCGAAGCCTACGAGCTCGCGAGAAGCCTCGTCGCGCAA
ATGACGCTGATGGAAAAGGTCAAGCTCACGGGAGGCGTCAAGCTCGGGACCGGCTGCTCCGGCTCCGTCATGCCC
GTGGCCCGGTTGGGATTCCCGGGCATGTGCTTCAGCGACGCGGGGAACGGGCTTCGGGCTACGGACTTTGTGAAT
GCGTATCCGAGCGGGATTCATGTCGGGGCCAGTTGGAACAAGGGCCTCGCTCGCAGGCGTGCCTCGGCCATGGCT
GCCGAGTTCCGCAGGAAGGGCGTCAACGTGCTTCTCGGTCCCGTCGTCGGGCCTGTTGGTCGTGTCGTTGGAGGG
GGCCGCAACTGGGAGGCCTTTTCCGTCGACCCCTATCTCTCGGGCGTGCTCGTGGCCGAGACGGTAGAGGGTATT
CAGGGCGAAGGGGTGCAGGCCAGCGTCAAGCATTATGTTGCTAATGAACAGGAAGATTACCGCTCTCCCGAGACT
GGACGCGAGGCCATCTCTTCCAACGTGGATGACAGGACCATGCATGAGCTTTATCTATGGGCCTTTCAAGACGCC
GTCAAGGCCGGCTGCGCCAACATCATGTGCTCATACCAACGCATCAACAACTCGTACGGCTGCGCCAACAGCAAG
ACGCTCAACGGCCTGCTCAAGACGGAGCTCGGCTTCCAGCATGCGGGAGTCGCTACGGCGCTGGCGGGCTTGGAT
CTGGCCATGCCGAGCGGTGCTGAGTTTTGGGGCGAGCATCTGCTGGAGGCTGTGAGGAATGGACTCATGACGACC
TGGTTCCAGTTCAGGCAAAACGACTCGTTCCCCAACCCCGGCTTCGGCATGCCGGAAAAGCTCCTCGGACCGCAC
ACGCCCGTCGAAGGCCGAGACGACAGTTCCCGCCAGATACTCCTCGATGGAGCCCTCGAGGGCCACGTTCTCGTC
AAGAACACAAAGGAAACGCTGCCCCTGAAGCGGCCCCGGATGCTGTCCGTCTTCGGCTACTCGGCCAAATCGGCC
GACGACTGGGGACCCTCGACGGACGAGAACCTCAACAACGCCTACGCGTACGGCGTCATCCCGCTCGACCCCGAG
GGAAGGCTGGCCAGCCTCTTCTCCTGGGTCGAGCGGCCGGCCACGGCCAGACGGGGGACCCTGATCGGCGGAGGC
GGCTCCGGGGCCGTCACGCCCGCCGTCTTCACCGCTCCCTTCGAGGCACTCAAGGTCCGGGCAGCCCGAGACGAC
ACGGCCCTCATGTACGACTTGGTCTCGGAGCGGCCCGGCGTCGACCCGGCGTCGGATGCCTGCCTCGTCTTGGCC
AACGCCTGGGCCGCCGAGGGCTACGACCGGCCGGCTCTCTACGACAACTACACCGACGGCCTGATCCGGGCCGTG
GCCGACGGGTGCGCCCGGACGGTGGTGGTGCTGCACAACGCCGGCGTCCGGATCGTCGACGGCTTCATCCATCAC
GAAAACGTCACGGCCGTCATCATGGCACATCTCCCGGGCCGGGACAGCGGAGAGGCCCTCGTCTCGCTCCTCTAC
GGCGACGCCAACCCGTCCGGTAAGCTGCCCTATACCGTGGCCCGGGCCGAGTCCGACTACGGGCCCGTGGTGGGG
CCGGACCAGCCGCGGGGGGACTACAGTCGGTTCCCGCAGTCCGACTTTACCGAGGGGACCATGCTCGACTACCGC
GGCTTCGACCGGGACGGGAAGCAGCCCCGGTTCGAGTTCGGCTTCGGCCTCAGCTACACGACCTTTGCCCTCTCG
GACCTGACGATACGGACGGAAAAGGAGGCCCACGACGGGCCGCTCCCGACGGGTACCGTGACGGCGGGCGGACCG
TCGGACCTCTGGGACGTCATGGCGACGGTGGAGGCGACGGTGACGAACACGGGCTCCGTGACGGGGGCCGAGGTG
GTGCAGCTGTACCTGGGGTTCCCCGGGGACGACTCTCCGGTCCGGCAGCTGCGGGGCTTCGACAAGGTGAGGCTC
CGGCCGGGCGAGAGACGGACGGTCCGGTTCGGCCTGACGAGGAGGGACCTGAGCCGCTGGGACGTGGTGGTCCAG
GGCTGGAGGCTCGCCGACGGGGGCTTCGGCGTGTTTGTCGGGAACAGCAGCCGGGTGTTTGGTCTGAGTGGCAGG
CTGGAGCTGTGA
Transcript >Ophcf2|00746
ATGTGCTTCTGCCTCCGCAGCAAGGGTTCCAACGAGCTGGCCCGCTCGCGCGACATCGACCGGGCGCTCCGTCAG
GATGAGAAGCGAAAGTCGAGGGAGGTGAAGCTGCTGCTACTCGGAGCCGGCGAATCGGGCAAATCCACCATCCTG
AAGCAGATGAAGCTCATCTACTCGCAGGGCTTCAGCAAACATGAGCGACTCGAGTGGAAGAACATCATCTTTGGC
AACATCATTCAATCCTTCCGTACCATCTCCGAGGCCATGACGGAGATGGGCCTTCAGTACGACAAGCCCGATCAC
GAGAAATACATGGCGCACATCCTCGTCGAGCCGGAAATCAGCCTGCATGAAAGCCTCCCGCGTGATTACATGGAG
CCAATCAAGGCCCTGTGGAAGGATAGCGGCGTCAGGGCAGCCATTGCAAAGGGCAACGAATACGCGCTGCACGAC
AATCTGGCGTACTTCCTCCAAGACATCGACCGCATCTGGGCCGAGGGCTACGTCCCGAGCGACCAGGATCTCCTC
CGGTCCCGGCTCCGGACGACGGGCATCACCGAGACCGAATTCGACCTCGGGCAGCTCACCTATCGCATGTTTGAC
GTCGGTGGGCAGCGGTCGGAGCGCAAGAAGTGGATTCACTGCTTCGAGAACGTCACTTGCTTGATGTTTCTCGTC
GCCATCAGCGGCTACGATCAGTGCCTGGTCGAGGATAAAGCTGGGAACCAGATGAACGAGGCCCTCATGCTGTGG
GAGTCCATCATCAACTCGTTCTGGTTCAAGAAGTCGGCCATGATCCTCTTCCTCAACAAGATAGACCTCTTCAAA
GAGAAGCTCGCCCACAACCCCATCACCAAGCACGGCTTCACCGACTACCAGGGCGCTCCCGACGACTGGAACGCG
GCCAGCAAGTACTTCCTCGAAAAGTTCCGTAACCAGAGCCGAAACCCGGACAAGGAGATCTACTGTCATCTGACC
AACGCGACCGACACGAACCTGCTCAAGATCACCATGGGCTCTGTGCAGGACTTGATCATCCAGCGGAATCTCAAG
ACGCTGATTCTGGATGCAGACATGGACAAGAATATAGAGACGAGGGAGCCTCCAGCCGAGAAGGAGCTCTTAGGC
CCCAACCCGAAACAGTCGACATCGAGCCCGATCTCGACCATGATGGCCATGATTCTCGGTCCTCTCCTACTCGCC
GCTTCTGTTCTCGCCCTTCTGGCCGCAGGAGCCGCGCCCAAAGACGATGGCTTCTTCTACGGCCGTTCACCGCCC
GTGTATCCATCGCCGGCCATGACGGGCGGTGAATGGACCGAAGCCTACGAGCTCGCGAGAAGCCTCGTCGCGCAA
ATGACGCTGATGGAAAAGGTCAAGCTCACGGGAGGCGTCAAGCTCGGGACCGGCTGCTCCGGCTCCGTCATGCCC
GTGGCCCGGTTGGGATTCCCGGGCATGTGCTTCAGCGACGCGGGGAACGGGCTTCGGGCTACGGACTTTGTGAAT
GCGTATCCGAGCGGGATTCATGTCGGGGCCAGTTGGAACAAGGGCCTCGCTCGCAGGCGTGCCTCGGCCATGGCT
GCCGAGTTCCGCAGGAAGGGCGTCAACGTGCTTCTCGGTCCCGTCGTCGGGCCTGTTGGTCGTGTCGTTGGAGGG
GGCCGCAACTGGGAGGCCTTTTCCGTCGACCCCTATCTCTCGGGCGTGCTCGTGGCCGAGACGGTAGAGGGTATT
CAGGGCGAAGGGGTGCAGGCCAGCGTCAAGCATTATGTTGCTAATGAACAGGAAGATTACCGCTCTCCCGAGACT
GGACGCGAGGCCATCTCTTCCAACGTGGATGACAGGACCATGCATGAGCTTTATCTATGGGCCTTTCAAGACGCC
GTCAAGGCCGGCTGCGCCAACATCATGTGCTCATACCAACGCATCAACAACTCGTACGGCTGCGCCAACAGCAAG
ACGCTCAACGGCCTGCTCAAGACGGAGCTCGGCTTCCAGCATGCGGGAGTCGCTACGGCGCTGGCGGGCTTGGAT
CTGGCCATGCCGAGCGGTGCTGAGTTTTGGGGCGAGCATCTGCTGGAGGCTGTGAGGAATGGACTCATGACGACC
TGGTTCCAGTTCAGGCAAAACGACTCGTTCCCCAACCCCGGCTTCGGCATGCCGGAAAAGCTCCTCGGACCGCAC
ACGCCCGTCGAAGGCCGAGACGACAGTTCCCGCCAGATACTCCTCGATGGAGCCCTCGAGGGCCACGTTCTCGTC
AAGAACACAAAGGAAACGCTGCCCCTGAAGCGGCCCCGGATGCTGTCCGTCTTCGGCTACTCGGCCAAATCGGCC
GACGACTGGGGACCCTCGACGGACGAGAACCTCAACAACGCCTACGCGTACGGCGTCATCCCGCTCGACCCCGAG
GGAAGGCTGGCCAGCCTCTTCTCCTGGGTCGAGCGGCCGGCCACGGCCAGACGGGGGACCCTGATCGGCGGAGGC
GGCTCCGGGGCCGTCACGCCCGCCGTCTTCACCGCTCCCTTCGAGGCACTCAAGGTCCGGGCAGCCCGAGACGAC
ACGGCCCTCATGTACGACTTGGTCTCGGAGCGGCCCGGCGTCGACCCGGCGTCGGATGCCTGCCTCGTCTTGGCC
AACGCCTGGGCCGCCGAGGGCTACGACCGGCCGGCTCTCTACGACAACTACACCGACGGCCTGATCCGGGCCGTG
GCCGACGGGTGCGCCCGGACGGTGGTGGTGCTGCACAACGCCGGCGTCCGGATCGTCGACGGCTTCATCCATCAC
GAAAACGTCACGGCCGTCATCATGGCACATCTCCCGGGCCGGGACAGCGGAGAGGCCCTCGTCTCGCTCCTCTAC
GGCGACGCCAACCCGTCCGGTAAGCTGCCCTATACCGTGGCCCGGGCCGAGTCCGACTACGGGCCCGTGGTGGGG
CCGGACCAGCCGCGGGGGGACTACAGTCGGTTCCCGCAGTCCGACTTTACCGAGGGGACCATGCTCGACTACCGC
GGCTTCGACCGGGACGGGAAGCAGCCCCGGTTCGAGTTCGGCTTCGGCCTCAGCTACACGACCTTTGCCCTCTCG
GACCTGACGATACGGACGGAAAAGGAGGCCCACGACGGGCCGCTCCCGACGGGTACCGTGACGGCGGGCGGACCG
TCGGACCTCTGGGACGTCATGGCGACGGTGGAGGCGACGGTGACGAACACGGGCTCCGTGACGGGGGCCGAGGTG
GTGCAGCTGTACCTGGGGTTCCCCGGGGACGACTCTCCGGTCCGGCAGCTGCGGGGCTTCGACAAGGTGAGGCTC
CGGCCGGGCGAGAGACGGACGGTCCGGTTCGGCCTGACGAGGAGGGACCTGAGCCGCTGGGACGTGGTGGTCCAG
GGCTGGAGGCTCGCCGACGGGGGCTTCGGCGTGTTTGTCGGGAACAGCAGCCGGGTGTTTGGTCTGAGTGGCAGG
CTGGAGCTGTGA
Gene >Ophcf2|00746
ATGTGCTTCTGCCTCCGCAGCAAGGGTTCCAACGAGCTGGCCCGCTCGCGCGACATCGACCGGGCGCTCCGTCAG
GATGAGAAGCGAAAGTCGAGGGAGGTGAAGCTGCTGCTACTCGGTGAGTCTTTATGTTGTTGTGGCCCCCTGGGA
ATCCCCCGTAGCATTCCCCCATGGCATTCTCCCACGGCATGCCCCCACGGTATATCCTCTTTGCTGACCCAACAG
CCAGGAGCCGGCGAATCGGGCAAATCCACCATCCTGAAGCAGATGAAGCTCATCTACTCGCAGGGCTTCAGCAAA
CATGAGCGACTCGAGTGGAAGAACATCATCTTTGGCAACATCATTCAATCCTTCCGTACCATCTCCGAGGCCATG
ACGGAGATGGGCCTTCAGTACGACAAGCCCGATCACGAGGTGAGGCTCAGACGGGCCAGAAAAGACGGGCGAGAC
CGCCACTGACTCCAGCTGCAGAAATACATGGCGCACATCCTCGTCGAGCCGGAAATCAGCCTGCATGAAAGCCTC
CCGCGTGATTACATGGAGCCAATCAAGGCCCTGTGGAAGGATAGCGGCGTCAGGGCAGCCATTGCAAAGGGCAAC
GAATACGCGCTGCACGACAATCTGGCGTAGTACGACGACACCCTTTTCTTGTCCCCTGATTGTCCCCTGATTGTC
CCCTGATTGTCCCCCATCGTCCCTCCGTCACCGTCGTTGACTCATCCCACAGCTTCCTCCAAGACATCGACCGCA
TCTGGGCCGAGGGCTACGTCCCGAGCGACCAGGATCTCCTCCGGTCCCGGCTCCGGACGACGGGCATCACCGAGA
CCGAATTCGACCTCGGGCAGCTCACCTATCGCATGTTTGACGTCGGTGGGCAGCGGTCGGAGCGCAAGAAGTGGA
TTCACTGCTTCGAGAACGTCACTTGCTTGATGTTTCTCGTCGCCATCAGCGGCTACGATCAGTGCCTGGTCGAGG
ATAAAGCTGGGGTGAGAAAAGCAACCAACGGACGTCTTGCTCCTTACCGTCTTGTTTTACTGACGGCCTGCAAAG
AACCAGATGAACGAGGCCCTCATGCTGTGGGAGTCCATCATCAACTCGTTCTGGTTCAAGAAGTCGGCCATGATC
CTCTTCCTCAACAAGATAGACCTCTTCAAAGAGAAGCTCGCCCACAACCCCATCACCAAGCACGGCTTCACCGAC
TACCAGGGCGCTCCCGACGACTGGAACGCGGCCAGCAAGTACTTCCTCGAAAAGTTCCGTAACCAGAGCCGAAAC
CCGGACAAGGAGATCTACTGTCATCTGACCAACGCGACCGACACGAACCTGCTCAAGATCACCATGGGCTCTGTG
CAGGACTTGATCATCCAGCGGAATCTCAAGACGCTGATTCTGTGAGGCCGTGAGGCTGAGCTGGCTGGCTGTGAG
TTGCGCGCGCATGGGGTCTGAAACCTCGCTCGTCTCTCCCTGGATTGGAGGCGAGCACATACAGCGATACCCTAC
ATATACACTCATACACACTCACTCGCACACGCACTCGCACACTCGCACACTCGCACACTCGCACACCCACACTTA
CACACTCGCTCTCACACACAAACACCCCCTCGCGAGCCTCTCCCGTCTCCCTCAACCCCCAGAGCAAAAAGAAGC
CGGCTGCCGCCACGGACAGACGCGTCGCGGGTTCCTCGTCAGAGAGGCCGCAGCTCCGAGATGATGGACATGGCC
CGCTCGGCTTCCGGGTCGGAGCCGGGACGGGGGGCGGAACAGGTGGGACATACGGATGATACCCGGGCCGTTGTT
GTCTAGGATGTGAGACAGCCTGACAGGAATGCCTAGTAGGTTGAGAAATCTAGCACGAGATGATTGATTGATAGG
TAGGTATCTACTACATGCTGGATATGGGGGAGTTGTTGCTCTGTTGCTTGTCGTGGCAACTGCCTAATCTACCTT
GTGTATCGTAACAAGTCTGTGTCTACCTACCTACCTACCTACCTACCTACCTACCTACCTAGGTATGCTTCCTTG
ATGTTTCCTCTCTTCTCTTTCTCAGTCTCTCTTCCCGCCTCTGTTCCTTGCTACTTGCTAGTTACTACCTTGGCT
ACCTAGCAACCTAATCAATCATTCATCGACCCCCTTTCCTCGACGGTAGAATCGAATACATACCTACCTACCTAC
CTACATTCTCTCTCCTGTCTCGGGAAGCCGTCCTTCCCCGCACGGCAAGCCAATAATAGCGCATCCATGCAGTCC
AGTTGCACCGACGCACGCTGGCGTCAGTGTCTGTATGCACTTACCAACGTTGGACGCCACCACGAGACACGGGCG
TCTCAGAAGGGAAGAGCCACAAGGGATGCAGACATGGACAAGAATATAGAGACGAGGGAGCCTCCAGCCGAGAAG
GAGCTCTTAGGCCCCAACCCGAAACAGTCGACATCGAGCCCGATCTCGACCATGATGGCCATGATTCTCGGTCCT
CTCCTACTCGCCGCTTCTGTTCTCGCCCTTCTGGCCGCAGGAGCCGCGCCCAAAGACGATGGCTTCTTCTACGGC
CGTTCACCGCCCGTGTATCCATCGCGTGAGTCGCAAGTTATTCCTGGACGCGAGACGACGCGTGTCGGACGAGAA
GGGCTAAGAGGAAGCAACAGCGGCCATGACGGGCGGTGAATGGACCGAAGCCTACGAGCTCGCGAGAAGCCTCGT
CGCGCAAATGACGCTGATGGAAAAGGTCAAGCTCACGGGAGGCGTCAAGCTCGGGACCGGCTGCTCCGGCTCCGT
CATGCCCGTGGCCCGGTTGGGATTCCCGGGCATGTGCTTCAGCGACGCGGGGAACGGGCTTCGGGCTACGGACTT
TGTGAATGCGTATCCGAGCGGGATTCATGTCGGGGCCAGGTGAAGCCATATCGGAGAGTTGTCGAGACGTGGAGA
GAGTAAGAGCTGATGATGCTCCATGATAAGTTGGAACAAGGGCCTCGCTCGCAGGCGTGCCTCGGCCATGGCTGC
CGAGTTCCGCAGGAAGGGCGTCAACGTGCTTCTCGGTCCCGTCGTCGGGCCTGTTGGTCGTGTCGTTGGAGGGGG
CCGCAACTGGGAGGCCTTTTCCGTCGACCCCTATCTCTCGGGCGTGCTCGTGGCCGAGACGGTAGAGGGTATTCA
GGGCGAAGGGGTGCAGGCCAGCGTCAAGGTTGGTTGGCCTCTTTTCTCGTCTCCGTCTCTGTTGGCCGACTGACG
GGTTCTTCTCTTTCGGTAGCATTATGTTGCTAATGAACAGGAAGATTACCGCTCTCCCGAGACTGGACGCGAGGC
CATCTCTTCCAACGTGGATGACAGGACCATGCATGAGCTTTATCTATGGTGAGTCTCCGTGTTGACGTAGACGAC
ATCTTGCCTCTCCTAACTCGCAGTCCTAAAGGGCCTTTCAAGACGCCGTCAAGGCCGGCTGCGCCAACATCATGT
GCTCATACCAACGCATCAACAACTCGTACGGCTGCGCCAACAGCAAGACGCTCAACGGCCTGCTCAAGACGGAGC
TCGGCTTCCAGGTATGAATTGCCGACTTGACTGACCCCGTCTGTCTCTTTGCAGACGACACGACGCCCCGGCTGA
CGATGATGATGATGATGATGATGATGATGATGCTCGTGGGCAGGGCTTCGTCGTGTCTGACTGGGGAGCTCAGCA
TGCGGGAGTCGCTACGGCGCTGGCGGGCTTGGATCTGGCCATGCCGAGCGGTGCTGAGTTTTGGGGCGAGCATCT
GCTGGAGGCTGTGAGGAATGGGTCCGTGTCTGAGGCTCGGGTCGACGACATGGTGACGAGGCGAGCTGCCCCTTT
TTACCACATCTCTTACTTGCGCTCATACACACACACACACACTCTCTCTCTCTCTCTCTCTCTAAACTCTCTCTC
TCTCTCTAAACTCTCCTCCCTCTCTTTACTTGTCCTCCCTCTCTCTGACCAAACACCCTCTCTGTTCACTTCCCC
CCGCTGACAACCCACCAACCTCCCTCCAGACTCATGACGACCTGGTTCCAGTTCAGGCAAAACGACTCGTTCCCC
AACCCCGGCTTCGGCATGCCGGAAAAGCTCCTCGGACCGCACACGCCCGTCGAAGGCCGAGACGACAGTTCCCGC
CAGATACTCCTCGATGGAGCCCTCGAGGGCCACGTTCTCGTCAAGAACACAAAGGAAACGCTGCCCCTGAAGCGG
CCCCGGATGCTGTCCGTCTTCGGCTACTCGGCCAAATCGGCCGACGACTGGGGACCCTCGACGGACGAGAACCTC
AACAACGCCTACGCGTACGGCGTCATCCCGCTCGACCCCGAGGGAAGGCTGGCCAGCCTCTTCTCCTGGGTCGAG
CGGCCGGCCACGGCCAGACGGGGGACCCTGATCGGCGGAGGCGGCTCCGGGGCCGTCACGCCCGCCGTCTTCACC
GCTCCCTTCGAGGCACTCAAGGTCCGGGCAGCCCGAGACGACACGGCCCTCATGTACGACTTGGTCTCGGAGCGG
CCCGGCGTCGACCCGGCGTCGGATGCCTGCCTCGTCTTGGCCAACGCCTGGGCCGCCGAGGGCTACGACCGGCCG
GCTCTCTACGACAACTACACCGACGGCCTGATCCGGGCCGTGGCCGACGGGTGCGCCCGGACGGTGGTGGTGCTG
CACAACGCCGGCGTCCGGATCGTCGACGGCTTCATCCATCACGAAAACGTCACGGCCGTCATCATGGCACATCTC
CCGGGCCGGGACAGCGGAGAGGCCCTCGTCTCGCTCCTCTACGGCGACGCCAACCCGTCCGGTAAGCTGCCCTAT
ACCGTGGCCCGGGCCGAGTCCGACTACGGGCCCGTGGTGGGGCCGGACCAGCCGCGGGGGGACTACAGTCGGTTC
CCGCAGTCCGACTTTACCGAGGGGACCATGCTCGACTACCGCGGCTTCGACCGGGACGGGAAGCAGCCCCGGTTC
GAGTTCGGCTTCGGCCTCAGCTACACGACCTTTGCCCTCTCGGACCTGACGATACGGACGGAAAAGGAGGCCCAC
GACGGGCCGCTCCCGACGGGTACCGTGACGGCGGGCGGACCGTCGGACCTCTGGGACGTCATGGCGACGGTGGAG
GCGACGGTGACGAACACGGGCTCCGTGACGGGGGCCGAGGTGGTGCAGCTGTACCTGGGGTTCCCCGGGGACGAC
TCTCCGGTCCGGCAGCTGCGGGGCTTCGACAAGGTGAGGCTCCGGCCGGGCGAGAGACGGACGGTCCGGTTCGGC
CTGACGAGGAGGGACCTGAGCCGCTGGGACGTGGTGGTCCAGGGCTGGAGGCTCGCCGACGGGGGCTTCGGCGTG
TTTGTCGGGAACAGCAGCCGGGTGTTTGGTCTGAGTGGCAGGCTGGAGCTGTGA

© 2023 - Robin Ohm - Utrecht University - The Netherlands

Built with Python Django and Wagtail