Fungal Genomics

at Utrecht University

General Properties

Protein IDOphcf2|00738
Gene name
Locationscaffold_01:2816231..2819112
Strand+
Gene length (bp)2881
Transcript length (bp)2631
Coding sequence length (bp)2631
Protein length (aa) 877

Overview

Your browser does not support drawing a protein figure.

PFAM Domains

PFAM Domain ID Short name Long name E-value Start End
PF16158 N_BRCA1_IG Ig-like domain from next to BRCA1 gene 2.7E-34 648 760
PF00569 ZZ Zinc finger, ZZ type 2.8E-05 351 388
PF00569 ZZ Zinc finger, ZZ type 8.2E-08 418 456

GO

GO Term Description Terminal node
GO:0008270 zinc ion binding Yes
GO:0043169 cation binding No
GO:0046914 transition metal ion binding No
GO:0043167 ion binding No
GO:0003674 molecular_function No
GO:0046872 metal ion binding No
GO:0005488 binding No

Deeploc

[Help with interpreting the results of Deeploc 2.0]
Localizations Signals Cytoplasm Nucleus Extracellular Cell membrane Mitochondrion Plastid Endoplasmic reticulum Lysosome vacuole Golgi apparatus Peroxisome
Cytoplasm|Nucleus Nuclear localization signal 0.6926 0.5504 0.108 0.1837 0.1527 0.0219 0.2193 0.1284 0.1704 0.005

SignalP

(None)

Transmembrane Domains

(None)

Transcription Factor Class

(None)

CAZymes

(None)

Secondary Metabolism

(None)

Expression data

Analysis 1: Expression analysis during behavioral modification. Published in: Will et al., G3, 2020

Click here for more information

Orthologs

Orthofinder run ID4
Orthogroup4257
Change Orthofinder run
Species Protein ID
Ophiocordyceps australis 1348a (Ghana) OphauG2|4088
Ophiocordyceps australis map64 (Brazil) OphauB2|1988
Ophiocordyceps camponoti-floridani Ophcf2|00738 (this protein)
Ophiocordyceps camponoti-rufipedis Ophun1|6074
Ophiocordyceps kimflemingae Ophio5|6750
Ophiocordyceps subramaniannii Hirsu2|8704

Sequences

Type of sequenceSequence
Locus Download genbank file of locus Download genbank file of locus (reverse complement)
The gene with 5 kb flanks (if sufficient flanking sequence is available). For use in cloning design programs. NOTE: features (genes or exons) that are only partially contained within the sequence are completely excluded.
Protein >Ophcf2|00738
MSSAAQTAGTTVAPVTVKILYDGNTRRAKMSLREMVPKALEQHVRNSLQIPDHVKLMIERYSDSAAAYVLLDSAN
ASIYKQLYRAAKAKGKLKLRVTIAGGGTTAAAVSDQAPLDPPRPVVEEAPTVPQSLSPVPSISMPYTQNAHLLAA
RRTEAAIAAMSQHHRWMTDDLMSDEMVPVWEGSDFKDRLGQLEERLRATTISSQNPCDHGDVQRTRLTSQCPLAG
SNFAVCCNSCERTIPDSHFHCSTCDDGDFDLCQACVDHGISCYNNDHWLIRRVVKDGQLVNSTTEIIPSKPKPKP
APKIKLEDEADNLVPPPPPRPAADYLVPRFISRTAGDYCYPRSPYVNTTRTCNCCVLELHERQFLHCTVCDDFDL
CQRCFVKDKHGHHPKHGFVPAVDGALISDAIKAKMSPGRDQVHHAICDGCDKYITGIRYKCLDCPDWDYCSGCIE
TAHYVHAEHRFVPVYEPLAMSQACAASQSVHSGVCCDGPLCSATTFPSYIRGVRYKCAVCHDLDFCASCEASPAN
THNKTHPLIKFKTPVRHVSVTTTGEHQDGNRMPAMGDRNKAAPTTCVTDRNSINAVQTVVDVEPLEHPVPVSKWE
ADVVDKSDEPVKEMPLEYDVDLPWSGSTASEITAAEKDLRAVFVRDSVEDGTIMAPNHLFEQTWILRNEGTVAWP
PGCSVRFVGGDYMGRVDSNHPACISELVSASESTICHVPLDPGQEFSFTVLLRTPPRSGKVISYWRLTTSYGHKF
GHRLWCEVNVRPDTTEPRPQVSVVHIEDVKEHASQDASTLSSSTMVFPKLVKESLEASLHDESPQKEEEKAQAET
QSAQADTEEGLEGCGEDDSWDDEDFLTDEEYDILDASDEEFLEQQKKAAKK*
Coding >Ophcf2|00738
ATGTCGTCCGCCGCACAGACTGCGGGCACTACTGTTGCCCCCGTCACCGTCAAGATTCTCTATGATGGAAACACT
CGTCGGGCCAAGATGTCTCTCCGCGAGATGGTTCCCAAGGCCCTCGAGCAGCACGTTCGAAATTCTCTGCAGATC
CCGGACCACGTCAAACTCATGATTGAACGTTACTCCGATTCCGCTGCCGCCTACGTCCTGCTCGACTCGGCCAAC
GCTTCCATCTACAAGCAGCTGTATCGGGCTGCCAAGGCAAAGGGAAAACTCAAGCTTCGCGTCACCATCGCCGGG
GGCGGAACCACTGCCGCCGCAGTCTCTGATCAAGCACCCCTTGACCCTCCCCGTCCGGTCGTCGAAGAGGCCCCT
ACGGTGCCCCAGAGCCTGTCGCCCGTCCCGAGTATCTCGATGCCGTATACGCAGAATGCCCATCTTCTTGCGGCT
CGTCGGACCGAGGCCGCGATTGCCGCCATGTCTCAGCATCATCGCTGGATGACGGATGATTTGATGTCGGACGAG
ATGGTGCCGGTATGGGAAGGATCCGACTTCAAGGACCGTCTTGGCCAACTCGAGGAGAGACTCCGTGCCACCACC
ATCTCGTCTCAGAACCCGTGCGATCATGGCGACGTCCAGAGGACCAGGCTCACATCCCAATGCCCCTTGGCCGGC
AGTAATTTCGCAGTCTGCTGCAACAGCTGCGAGAGGACCATCCCGGACTCTCACTTTCACTGCTCCACCTGCGAC
GATGGCGACTTCGACCTCTGCCAGGCCTGCGTCGATCACGGCATCTCGTGCTACAACAACGACCACTGGCTCATC
AGGCGTGTCGTCAAGGACGGCCAGCTTGTCAACAGCACGACTGAGATCATCCCCTCCAAGCCCAAGCCCAAGCCC
GCCCCCAAGATCAAGCTCGAGGACGAAGCCGACAACTTGGTTCCTCCTCCACCACCCCGTCCCGCCGCCGACTAC
CTCGTCCCCAGGTTCATATCTCGGACCGCGGGCGACTATTGTTATCCTCGTTCGCCTTACGTCAACACCACGCGT
ACTTGCAACTGCTGCGTTCTAGAACTCCATGAGCGGCAGTTCCTCCACTGCACCGTCTGCGACGACTTTGACCTT
TGCCAGCGATGCTTCGTCAAGGACAAACACGGGCATCATCCCAAGCACGGATTCGTCCCCGCTGTTGACGGCGCC
CTTATCTCTGATGCCATCAAGGCCAAGATGTCCCCCGGCCGGGACCAGGTTCACCACGCCATTTGTGATGGTTGT
GACAAGTACATCACGGGGATTCGCTACAAGTGCCTCGACTGCCCGGACTGGGACTATTGCTCGGGGTGCATCGAA
ACCGCTCATTACGTGCACGCGGAGCATCGCTTCGTGCCCGTCTACGAGCCCCTAGCCATGTCCCAGGCCTGTGCG
GCCTCGCAGTCTGTTCACTCGGGCGTCTGCTGTGACGGTCCTCTTTGCTCAGCCACGACGTTCCCGTCTTACATT
CGCGGTGTCCGGTACAAGTGTGCCGTCTGCCACGACCTCGACTTCTGCGCCAGTTGCGAAGCGAGCCCTGCCAAC
ACTCACAACAAGACGCACCCGCTCATCAAGTTCAAGACGCCCGTCCGCCACGTGAGCGTCACCACCACCGGCGAG
CACCAGGATGGTAATCGCATGCCGGCCATGGGCGATCGCAACAAGGCGGCCCCGACGACGTGCGTCACCGACCGC
AACTCGATCAATGCTGTGCAGACGGTCGTAGACGTCGAGCCACTGGAGCACCCGGTCCCCGTCAGCAAGTGGGAG
GCTGACGTCGTCGACAAGTCGGATGAGCCCGTCAAGGAGATGCCGTTGGAGTACGATGTCGACCTGCCCTGGTCT
GGATCCACGGCGTCTGAGATTACGGCGGCGGAGAAGGACCTGCGCGCCGTCTTCGTGCGTGACTCTGTCGAGGAC
GGTACAATCATGGCCCCCAACCACCTCTTTGAACAGACCTGGATTCTCCGCAACGAGGGTACCGTGGCCTGGCCC
CCCGGGTGCTCCGTCAGGTTCGTCGGCGGAGACTACATGGGCCGCGTCGATTCGAACCATCCTGCGTGCATCTCG
GAGCTCGTCTCCGCCTCCGAATCGACCATTTGCCACGTGCCGCTCGATCCTGGCCAGGAGTTCTCCTTTACAGTC
TTGCTGCGCACGCCTCCCCGTTCCGGCAAGGTCATCTCGTACTGGCGCCTCACGACGAGCTACGGTCACAAGTTT
GGCCACCGTTTGTGGTGCGAGGTCAATGTTCGCCCTGACACGACGGAGCCCCGGCCCCAGGTCTCCGTCGTTCAC
ATTGAGGACGTCAAGGAGCATGCATCGCAGGATGCTTCGACTCTCTCCAGCAGCACCATGGTTTTCCCCAAACTC
GTCAAGGAGTCGCTCGAGGCTAGCTTGCATGACGAGTCGCCTCAGAAGGAGGAGGAGAAGGCTCAAGCCGAGACG
CAGTCCGCCCAGGCCGATACCGAGGAAGGCCTCGAGGGTTGCGGAGAGGACGATTCCTGGGACGACGAAGACTTT
TTGACCGACGAAGAGTACGACATCCTAGATGCGTCGGACGAGGAGTTTTTGGAACAGCAAAAGAAGGCTGCCAAG
AAGTAA
Transcript >Ophcf2|00738
ATGTCGTCCGCCGCACAGACTGCGGGCACTACTGTTGCCCCCGTCACCGTCAAGATTCTCTATGATGGAAACACT
CGTCGGGCCAAGATGTCTCTCCGCGAGATGGTTCCCAAGGCCCTCGAGCAGCACGTTCGAAATTCTCTGCAGATC
CCGGACCACGTCAAACTCATGATTGAACGTTACTCCGATTCCGCTGCCGCCTACGTCCTGCTCGACTCGGCCAAC
GCTTCCATCTACAAGCAGCTGTATCGGGCTGCCAAGGCAAAGGGAAAACTCAAGCTTCGCGTCACCATCGCCGGG
GGCGGAACCACTGCCGCCGCAGTCTCTGATCAAGCACCCCTTGACCCTCCCCGTCCGGTCGTCGAAGAGGCCCCT
ACGGTGCCCCAGAGCCTGTCGCCCGTCCCGAGTATCTCGATGCCGTATACGCAGAATGCCCATCTTCTTGCGGCT
CGTCGGACCGAGGCCGCGATTGCCGCCATGTCTCAGCATCATCGCTGGATGACGGATGATTTGATGTCGGACGAG
ATGGTGCCGGTATGGGAAGGATCCGACTTCAAGGACCGTCTTGGCCAACTCGAGGAGAGACTCCGTGCCACCACC
ATCTCGTCTCAGAACCCGTGCGATCATGGCGACGTCCAGAGGACCAGGCTCACATCCCAATGCCCCTTGGCCGGC
AGTAATTTCGCAGTCTGCTGCAACAGCTGCGAGAGGACCATCCCGGACTCTCACTTTCACTGCTCCACCTGCGAC
GATGGCGACTTCGACCTCTGCCAGGCCTGCGTCGATCACGGCATCTCGTGCTACAACAACGACCACTGGCTCATC
AGGCGTGTCGTCAAGGACGGCCAGCTTGTCAACAGCACGACTGAGATCATCCCCTCCAAGCCCAAGCCCAAGCCC
GCCCCCAAGATCAAGCTCGAGGACGAAGCCGACAACTTGGTTCCTCCTCCACCACCCCGTCCCGCCGCCGACTAC
CTCGTCCCCAGGTTCATATCTCGGACCGCGGGCGACTATTGTTATCCTCGTTCGCCTTACGTCAACACCACGCGT
ACTTGCAACTGCTGCGTTCTAGAACTCCATGAGCGGCAGTTCCTCCACTGCACCGTCTGCGACGACTTTGACCTT
TGCCAGCGATGCTTCGTCAAGGACAAACACGGGCATCATCCCAAGCACGGATTCGTCCCCGCTGTTGACGGCGCC
CTTATCTCTGATGCCATCAAGGCCAAGATGTCCCCCGGCCGGGACCAGGTTCACCACGCCATTTGTGATGGTTGT
GACAAGTACATCACGGGGATTCGCTACAAGTGCCTCGACTGCCCGGACTGGGACTATTGCTCGGGGTGCATCGAA
ACCGCTCATTACGTGCACGCGGAGCATCGCTTCGTGCCCGTCTACGAGCCCCTAGCCATGTCCCAGGCCTGTGCG
GCCTCGCAGTCTGTTCACTCGGGCGTCTGCTGTGACGGTCCTCTTTGCTCAGCCACGACGTTCCCGTCTTACATT
CGCGGTGTCCGGTACAAGTGTGCCGTCTGCCACGACCTCGACTTCTGCGCCAGTTGCGAAGCGAGCCCTGCCAAC
ACTCACAACAAGACGCACCCGCTCATCAAGTTCAAGACGCCCGTCCGCCACGTGAGCGTCACCACCACCGGCGAG
CACCAGGATGGTAATCGCATGCCGGCCATGGGCGATCGCAACAAGGCGGCCCCGACGACGTGCGTCACCGACCGC
AACTCGATCAATGCTGTGCAGACGGTCGTAGACGTCGAGCCACTGGAGCACCCGGTCCCCGTCAGCAAGTGGGAG
GCTGACGTCGTCGACAAGTCGGATGAGCCCGTCAAGGAGATGCCGTTGGAGTACGATGTCGACCTGCCCTGGTCT
GGATCCACGGCGTCTGAGATTACGGCGGCGGAGAAGGACCTGCGCGCCGTCTTCGTGCGTGACTCTGTCGAGGAC
GGTACAATCATGGCCCCCAACCACCTCTTTGAACAGACCTGGATTCTCCGCAACGAGGGTACCGTGGCCTGGCCC
CCCGGGTGCTCCGTCAGGTTCGTCGGCGGAGACTACATGGGCCGCGTCGATTCGAACCATCCTGCGTGCATCTCG
GAGCTCGTCTCCGCCTCCGAATCGACCATTTGCCACGTGCCGCTCGATCCTGGCCAGGAGTTCTCCTTTACAGTC
TTGCTGCGCACGCCTCCCCGTTCCGGCAAGGTCATCTCGTACTGGCGCCTCACGACGAGCTACGGTCACAAGTTT
GGCCACCGTTTGTGGTGCGAGGTCAATGTTCGCCCTGACACGACGGAGCCCCGGCCCCAGGTCTCCGTCGTTCAC
ATTGAGGACGTCAAGGAGCATGCATCGCAGGATGCTTCGACTCTCTCCAGCAGCACCATGGTTTTCCCCAAACTC
GTCAAGGAGTCGCTCGAGGCTAGCTTGCATGACGAGTCGCCTCAGAAGGAGGAGGAGAAGGCTCAAGCCGAGACG
CAGTCCGCCCAGGCCGATACCGAGGAAGGCCTCGAGGGTTGCGGAGAGGACGATTCCTGGGACGACGAAGACTTT
TTGACCGACGAAGAGTACGACATCCTAGATGCGTCGGACGAGGAGTTTTTGGAACAGCAAAAGAAGGCTGCCAAG
AAGTAA
Gene >Ophcf2|00738
ATGTCGTCCGCCGCACAGACTGCGGGCACTACTGTTGCCCCCGTCACCGTCAAGATTCTCTATGATGGAAACACT
CGTCGGGCCAAGATGTCTCTCCGCGAGATGGTTCCCAAGGCCCTCGAGCAGCACGTACGTTTTTTTTTTTTTTTT
TTTTTTTTTTTGCAACGTCGTCCACGGCCCGTCTGCTTCGTGGGCATCAGTGCGAAAACACGGTCGGGTTCCAGA
CCTCGCCTCCTAACTGACCTTGGCTTTACAGGTTCGAAATTCTCTGCAGATCCCGGACCACGTCAAACTCATGAT
TGAACGTTACTCCGATTCCGCTGCCGCCTACGTCCTGCTCGACTCGGCCAACGCTTCCATCTACAAGCAGCTGTA
TCGGGCTGCCAAGGCAAAGGGAAAACTCAAGCTTCGCGTCACCATCGCCGGGGGCGGAACCACTGCCGCCGCAGT
CTCTGATCAAGCACCCCTTGACCCTCCCCGTCCGGTCGTCGAAGAGGCCCCTACGGTGCCCCAGAGCCTGTCGCC
CGTCCCGAGTATCTCGATGCCGTATACGCAGAATGCCCATCTTCTTGCGGCTCGTCGGACCGAGGCCGCGATTGC
CGCCATGTCTCAGCATCATCGCTGGATGACGGATGATTTGATGTCGGACGAGATGGTGCCGGTATGGGAAGGATC
CGACTTCAAGGACCGTCTTGGCCAACTCGAGGAGAGACTCCGTGCCACCACCATCTCGTCTCAGAACCCGTGCGA
TCATGGCGACGTCCAGAGGACCAGGCTCACATCCCAATGCCCCTTGGCCGGCAGTAATTTCGCAGTCTGCTGCAA
CAGCTGCGAGAGGACCATCCCGGACTCTCACTTTCACTGCTCCACCTGCGACGATGGCGACTTCGACCTCTGCCA
GGCCTGCGTCGATCACGGCATCTCGTGCTACAACAACGACCACTGGCTCATCAGGCGTGTCGTCAAGGACGGCCA
GCTTGTCAACAGCACGACTGAGATCATCCCCTCCAAGCCCAAGCCCAAGCCCGCCCCCAAGATCAAGCTCGAGGA
CGAAGCCGACAACTTGGTTCCTCCTCCACCACCCCGTCCCGCCGCCGACTACCTCGTCCCCAGGTTCATATCTCG
GACCGCGGGCGACTATTGTTATCCTCGTTCGCCTTACGTCAACACCACGCGTACTTGCAACTGCTGCGTTCTAGG
TGAATTTACTGCAGCAGCCGCCTCGTGCAATCCTTGAGCCCTACTGATGCTCTTCTAGAACTCCATGAGCGGCAG
TTCCTCCACTGCACCGTCTGCGACGACTTTGACCTTTGCCAGCGATGCTTCGTCAAGGACAAACACGGGCATCAT
CCCAAGCACGGATTCGTCCCCGCTGTTGACGGCGCCCTTATCTCTGATGCCATCAAGGCCAAGATGTCCCCCGGC
CGGGACCAGGTTCACCACGCCATTTGTGATGGTTGTGACAAGGTATGACTGGCCCTCGACTGCCGTGACTGATGG
GCTTGTCATGTCGTTGACGGCTTCGTTCTAGTACATCACGGGGATTCGCTACAAGTGCCTCGACTGCCCGGACTG
GGACTATTGCTCGGGGTGCATCGAAACCGCTCATTACGTGCACGCGGAGCATCGCTTCGTGCCCGTCTACGAGCC
CCTAGCCATGTCCCAGGCCTGTGCGGCCTCGCAGTCTGTTCACTCGGGCGTCTGCTGTGACGGTCCTCTTTGCTC
AGCCACGACGTTCCCGTCTTACATTCGCGGTGTCCGGTACAAGTGTGCCGTCTGCCACGACCTCGACTTCTGCGC
CAGTTGCGAAGCGAGCCCTGCCAACACTCACAACAAGACGCACCCGCTCATCAAGTTCAAGACGCCCGTCCGCCA
CGTGAGCGTCACCACCACCGGCGAGCACCAGGATGGTAATCGCATGCCGGCCATGGGCGATCGCAACAAGGCGGC
CCCGACGACGTGCGTCACCGACCGCAACTCGATCAATGCTGTGCAGACGGTCGTAGACGTCGAGCCACTGGAGCA
CCCGGTCCCCGTCAGCAAGTGGGAGGCTGACGTCGTCGACAAGTCGGATGAGCCCGTCAAGGAGATGCCGTTGGA
GTACGATGTCGACCTGCCCTGGTCTGGATCCACGGCGTCTGAGATTACGGCGGCGGAGAAGGACCTGCGCGCCGT
CTTCGTGCGTGACTCTGTCGAGGACGGTACAATCATGGCCCCCAACCACCTCTTTGAACAGACCTGGATTCTCCG
CAACGAGGGTACCGTGGCCTGGCCCCCCGGGTGCTCCGTCAGGTTCGTCGGCGGAGACTACATGGGCCGCGTCGA
TTCGAACCATCCTGCGTGCATCTCGGAGCTCGTCTCCGCCTCCGAATCGACCATTTGCCACGTGCCGCTCGATCC
TGGCCAGGAGTTCTCCTTTACAGTCTTGCTGCGCACGCCTCCCCGTTCCGGCAAGGTCATCTCGTACTGGCGCCT
CACGACGAGCTACGGTCACAAGTTTGGCCACCGTTTGTGGTGCGAGGTCAATGTTCGCCCTGACACGACGGAGCC
CCGGCCCCAGGTCTCCGTCGTTCACATTGAGGACGTCAAGGAGCATGCATCGCAGGATGCTTCGACTCTCTCCAG
CAGCACCATGGTTTTCCCCAAACTCGTCAAGGAGTCGCTCGAGGCTAGCTTGCATGACGAGTCGCCTCAGAAGGA
GGAGGAGAAGGCTCAAGCCGAGACGCAGTCCGCCCAGGCCGATACCGAGGAAGGCCTCGAGGGTTGCGGAGAGGA
CGATTCCTGGGACGACGAAGACTTTTTGACCGACGAAGAGTACGACATCCTAGATGCGTCGGACGAGGAGTTTTT
GGAACAGCAAAAGAAGGCTGCCAAGAAGTAA

© 2023 - Robin Ohm - Utrecht University - The Netherlands

Built with Python Django and Wagtail