Fungal Genomics

at Utrecht University

General Properties

Protein IDOphcf2|00734
Gene name
Locationscaffold_01:2803648..2804656
Strand-
Gene length (bp)1008
Transcript length (bp)1008
Coding sequence length (bp)1008
Protein length (aa) 336

Overview

Your browser does not support drawing a protein figure.

PFAM Domains

PFAM Domain ID Short name Long name E-value Start End
PF11312 Methyltransf_34 Putative SAM-dependent methyltransferase 3.1E-104 35 331

GO

(None)

Deeploc

[Help with interpreting the results of Deeploc 2.0]
Localizations Signals Cytoplasm Nucleus Extracellular Cell membrane Mitochondrion Plastid Endoplasmic reticulum Lysosome vacuole Golgi apparatus Peroxisome
Cytoplasm|Nucleus Nuclear localization signal 0.6153 0.7256 0.0116 0.0172 0.1369 0.0276 0.0954 0.1137 0.2288 0.0097

SignalP

(None)

Transmembrane Domains

(None)

Transcription Factor Class

(None)

CAZymes

(None)

Secondary Metabolism

(None)

Expression data

Analysis 1: Expression analysis during behavioral modification. Published in: Will et al., G3, 2020

Click here for more information

Orthologs

Orthofinder run ID4
Orthogroup5672
Change Orthofinder run
Species Protein ID
Ophiocordyceps australis 1348a (Ghana) OphauG2|4102
Ophiocordyceps australis map64 (Brazil) OphauB2|2001
Ophiocordyceps camponoti-floridani Ophcf2|00734 (this protein)
Ophiocordyceps camponoti-rufipedis Ophun1|2696
Ophiocordyceps kimflemingae Ophio5|2748
Ophiocordyceps subramaniannii Hirsu2|827

Sequences

Type of sequenceSequence
Locus Download genbank file of locus Download genbank file of locus (reverse complement)
The gene with 5 kb flanks (if sufficient flanking sequence is available). For use in cloning design programs. NOTE: features (genes or exons) that are only partially contained within the sequence are completely excluded.
Protein >Ophcf2|00734
MVGIKARKEPSGPSSNNSPTTATRVDHQQPLLDVFSSVFSDVISSNAFPSLLRDIKRALFDRDFAAAFSDERRLE
AYAARWSPPRALCYAATLVELTPRLQELLCGDDGDEDKDTVDTLRLLCVGGGAAELAAAAAYLRDNPSRVALTLV
DAAPWSHVVDLVHQRLCVAPTLSKYASAAAVAANAPFICGSRLSVDHCRHDVLSLSHHSLTELVGSHPLLVTLLF
TLNEMYAQGGLAKTTAFLRSLGEALPSSSLLLVMDSPGSYSEAAVGKDKRRYPMQWLLDHTLLDNETQGRRWEKL
ESRDSLWFRLPEALTYPIQLEDMRYQMHLYQLFKC*
Coding >Ophcf2|00734
ATGGTTGGAATCAAGGCTCGTAAGGAGCCATCCGGTCCCTCTAGCAACAACAGCCCAACCACCGCTACCCGAGTC
GATCACCAGCAGCCGCTTCTCGACGTCTTCTCCAGCGTCTTCAGCGACGTCATATCCTCGAACGCGTTCCCTTCT
CTCTTGCGCGACATCAAACGCGCCCTCTTCGACCGCGACTTCGCCGCCGCATTCTCCGACGAGCGCCGTCTCGAG
GCCTACGCCGCGCGATGGAGTCCTCCCCGAGCTCTCTGTTATGCGGCCACACTCGTCGAGCTCACCCCTCGGTTG
CAAGAGCTGTTGTGCGGTGATGACGGAGACGAAGATAAAGACACGGTTGACACCCTCCGTCTCCTCTGCGTGGGG
GGAGGCGCCGCCGAGCTTGCCGCCGCCGCCGCATACCTCCGCGACAACCCTTCTCGCGTCGCGCTGACGCTCGTG
GACGCTGCTCCGTGGTCGCATGTTGTCGATCTCGTCCACCAGCGGCTCTGCGTCGCACCTACGCTTTCAAAATAT
GCCTCGGCCGCAGCCGTGGCCGCCAATGCGCCCTTCATATGCGGCTCTCGTCTGTCTGTCGACCATTGCCGCCAC
GATGTGCTCTCCCTGTCGCACCACAGTCTCACCGAGCTAGTTGGCTCCCATCCACTTCTCGTCACCTTGCTCTTC
ACTCTCAACGAGATGTATGCTCAAGGTGGATTGGCCAAAACGACGGCTTTCCTACGTTCCTTGGGCGAGGCGCTC
CCGTCGTCGAGCCTGCTCCTCGTCATGGACAGTCCCGGCAGCTACTCCGAGGCCGCCGTCGGCAAAGACAAGAGA
CGCTACCCCATGCAGTGGCTGCTTGACCACACCCTGCTCGACAACGAGACTCAGGGCCGCCGATGGGAGAAGCTA
GAATCGCGCGACTCTCTATGGTTTCGTCTGCCCGAGGCTCTGACATACCCGATTCAGCTCGAGGACATGAGGTAT
CAGATGCACTTGTATCAATTATTCAAGTGTTAA
Transcript >Ophcf2|00734
ATGGTTGGAATCAAGGCTCGTAAGGAGCCATCCGGTCCCTCTAGCAACAACAGCCCAACCACCGCTACCCGAGTC
GATCACCAGCAGCCGCTTCTCGACGTCTTCTCCAGCGTCTTCAGCGACGTCATATCCTCGAACGCGTTCCCTTCT
CTCTTGCGCGACATCAAACGCGCCCTCTTCGACCGCGACTTCGCCGCCGCATTCTCCGACGAGCGCCGTCTCGAG
GCCTACGCCGCGCGATGGAGTCCTCCCCGAGCTCTCTGTTATGCGGCCACACTCGTCGAGCTCACCCCTCGGTTG
CAAGAGCTGTTGTGCGGTGATGACGGAGACGAAGATAAAGACACGGTTGACACCCTCCGTCTCCTCTGCGTGGGG
GGAGGCGCCGCCGAGCTTGCCGCCGCCGCCGCATACCTCCGCGACAACCCTTCTCGCGTCGCGCTGACGCTCGTG
GACGCTGCTCCGTGGTCGCATGTTGTCGATCTCGTCCACCAGCGGCTCTGCGTCGCACCTACGCTTTCAAAATAT
GCCTCGGCCGCAGCCGTGGCCGCCAATGCGCCCTTCATATGCGGCTCTCGTCTGTCTGTCGACCATTGCCGCCAC
GATGTGCTCTCCCTGTCGCACCACAGTCTCACCGAGCTAGTTGGCTCCCATCCACTTCTCGTCACCTTGCTCTTC
ACTCTCAACGAGATGTATGCTCAAGGTGGATTGGCCAAAACGACGGCTTTCCTACGTTCCTTGGGCGAGGCGCTC
CCGTCGTCGAGCCTGCTCCTCGTCATGGACAGTCCCGGCAGCTACTCCGAGGCCGCCGTCGGCAAAGACAAGAGA
CGCTACCCCATGCAGTGGCTGCTTGACCACACCCTGCTCGACAACGAGACTCAGGGCCGCCGATGGGAGAAGCTA
GAATCGCGCGACTCTCTATGGTTTCGTCTGCCCGAGGCTCTGACATACCCGATTCAGCTCGAGGACATGAGGTAT
CAGATGCACTTGTATCAATTATTCAAGTGTTAA
Gene >Ophcf2|00734
ATGGTTGGAATCAAGGCTCGTAAGGAGCCATCCGGTCCCTCTAGCAACAACAGCCCAACCACCGCTACCCGAGTC
GATCACCAGCAGCCGCTTCTCGACGTCTTCTCCAGCGTCTTCAGCGACGTCATATCCTCGAACGCGTTCCCTTCT
CTCTTGCGCGACATCAAACGCGCCCTCTTCGACCGCGACTTCGCCGCCGCATTCTCCGACGAGCGCCGTCTCGAG
GCCTACGCCGCGCGATGGAGTCCTCCCCGAGCTCTCTGTTATGCGGCCACACTCGTCGAGCTCACCCCTCGGTTG
CAAGAGCTGTTGTGCGGTGATGACGGAGACGAAGATAAAGACACGGTTGACACCCTCCGTCTCCTCTGCGTGGGG
GGAGGCGCCGCCGAGCTTGCCGCCGCCGCCGCATACCTCCGCGACAACCCTTCTCGCGTCGCGCTGACGCTCGTG
GACGCTGCTCCGTGGTCGCATGTTGTCGATCTCGTCCACCAGCGGCTCTGCGTCGCACCTACGCTTTCAAAATAT
GCCTCGGCCGCAGCCGTGGCCGCCAATGCGCCCTTCATATGCGGCTCTCGTCTGTCTGTCGACCATTGCCGCCAC
GATGTGCTCTCCCTGTCGCACCACAGTCTCACCGAGCTAGTTGGCTCCCATCCACTTCTCGTCACCTTGCTCTTC
ACTCTCAACGAGATGTATGCTCAAGGTGGATTGGCCAAAACGACGGCTTTCCTACGTTCCTTGGGCGAGGCGCTC
CCGTCGTCGAGCCTGCTCCTCGTCATGGACAGTCCCGGCAGCTACTCCGAGGCCGCCGTCGGCAAAGACAAGAGA
CGCTACCCCATGCAGTGGCTGCTTGACCACACCCTGCTCGACAACGAGACTCAGGGCCGCCGATGGGAGAAGCTA
GAATCGCGCGACTCTCTATGGTTTCGTCTGCCCGAGGCTCTGACATACCCGATTCAGCTCGAGGACATGAGGTAT
CAGATGCACTTGTATCAATTATTCAAGTGTTAA

© 2023 - Robin Ohm - Utrecht University - The Netherlands

Built with Python Django and Wagtail