Fungal Genomics

at Utrecht University

General Properties

Protein IDOphcf2|00731
Gene name
Locationscaffold_01:2744166..2746089
Strand+
Gene length (bp)1923
Transcript length (bp)1689
Coding sequence length (bp)1689
Protein length (aa) 563

Your browser does not support drawing a protein figure.

PFAM Domains

PFAM Domain ID Short name Long name E-value Start End
PF01222 ERG4_ERG24 Ergosterol biosynthesis ERG4/ERG24 family 7.3E-137 127 561

GO

GO Term Description Terminal node
GO:0016628 oxidoreductase activity, acting on the CH-CH group of donors, NAD or NADP as acceptor Yes
GO:0016020 membrane Yes
GO:0016126 sterol biosynthetic process Yes
GO:1901360 organic cyclic compound metabolic process No
GO:0110165 cellular anatomical entity No
GO:1901362 organic cyclic compound biosynthetic process No
GO:0008152 metabolic process No
GO:0006694 steroid biosynthetic process No
GO:0009058 biosynthetic process No
GO:1901576 organic substance biosynthetic process No
GO:0016491 oxidoreductase activity No
GO:0008202 steroid metabolic process No
GO:0003824 catalytic activity No
GO:0071704 organic substance metabolic process No
GO:0044238 primary metabolic process No
GO:0005575 cellular_component No
GO:0006629 lipid metabolic process No
GO:0003674 molecular_function No
GO:0008610 lipid biosynthetic process No
GO:1901615 organic hydroxy compound metabolic process No
GO:0016627 oxidoreductase activity, acting on the CH-CH group of donors No
GO:0016125 sterol metabolic process No
GO:0008150 biological_process No
GO:1901617 organic hydroxy compound biosynthetic process No

SignalP

[Help with interpreting these statistics]
SignalP signal predicted Location
(based on Ymax)
D score
(significance: > 0.45)
No 1 - 12 0.45

Transmembrane Domains

Domain # Start End Length
1 130 152 22
2 192 214 22
3 227 249 22
4 264 286 22
5 345 364 19
6 384 406 22
7 419 436 17
8 501 523 22

Transcription Factor Class

(None)

Expression data

Analysis 1: Expression analysis during behavioral modification. Published in: Will et al., G3, 2020

Expression values

Label Description Expression (RPKM) Confidence interval (low) Confidence interval (high)
Fungus Fungus in pure culture 64.94 37.36 92.52
Alive In ants, during behavior modification 121.61 61.71 181.52
Dead In ants, recently dead 142.32 75.54 209.09

Differential expression

Label1 Label2 Q-value Significant difference
Alive Fungus 0.001226 yes
Alive Dead 0.416460 no
Dead Fungus 0.000238 yes

Sequences

Type of sequenceSequence
Locus Download genbank file of locus
The gene with 5 kb flanks (if sufficient flanking sequence is available). For use in cloning design programs. NOTE: features (genes or exons) that are only partially contained within the sequence are completely excluded.
Protein >Ophcf2|00731
MSRYSLRQNPRKMVIEGMVPTPGTRRQSRRKPSFPLEDVDNDSSSAAETSTRARSLRSRRTASRQKAEDDTGEDD
GLSNGTRTDTGASDDTPTRPRKRVVSSRTKPAERVVDGWKPGQDPKLDLSGEFEFGGSIGTATMMLLFPLLMWYM
WIGATYFDGKLPVPTPDQTWLQFGAEMAGLVYAGAFPHAAAWFWYWSYLAFQAACYCLLPGVWGSGKPLPHEGGR
QLTYFCNAYASLYLTLAVLAVLHFSGLWPLYLALDHFGPLLSVAIISGFLVSVVAYVSAIYRGKQHRMTGHVIYD
FFMGAELNPRMFGILDFKMFCEVRMPWYMLLILSLGAAARQYDRYGYVSAEVLFLVMAHYLYANACAKGEELIVT
TWDMYYEKWGFMLIFWNLAGVPLSYCHCTIYLANHDPSEYRWNRWALAALYLAYLFWYWVWDSCNSQKNRFRAME
SGRLISRNTFPQVPWQTLHEPETIVSPQGTILVDGWYGLARKIHYTADVWFALSWGLITGFKSPFPWFYPVFFCC
MIAHRASRDIHRCRIKYGDAWLEYERRVPYLFIPYVI*
Coding >Ophcf2|00731
ATGTCGAGATACTCGCTGCGCCAGAACCCGAGAAAGATGGTCATAGAAGGCATGGTCCCGACGCCAGGAACGCGT
CGCCAATCGCGTCGCAAGCCCTCTTTCCCGCTCGAAGATGTCGACAATGACTCGAGCTCGGCGGCTGAGACGTCG
ACGCGTGCCCGTTCCCTTCGCAGCCGCCGTACGGCCTCTCGACAGAAGGCCGAGGATGATACTGGCGAGGACGAT
GGCTTGTCCAATGGCACCAGGACAGATACAGGCGCGTCCGACGACACTCCGACGCGGCCCAGGAAGCGCGTCGTC
TCTTCACGAACGAAGCCGGCGGAACGCGTCGTCGACGGCTGGAAGCCCGGCCAGGACCCCAAGCTCGACCTCTCT
GGCGAATTCGAGTTCGGAGGCTCGATAGGGACGGCTACCATGATGTTGCTCTTCCCCCTTCTCATGTGGTATATG
TGGATCGGAGCCACATACTTCGACGGCAAGCTTCCCGTCCCCACGCCCGACCAGACCTGGCTCCAGTTCGGCGCA
GAGATGGCCGGTCTCGTCTACGCCGGCGCGTTCCCTCATGCCGCCGCCTGGTTCTGGTACTGGTCATATCTCGCC
TTTCAGGCCGCCTGTTACTGTCTGCTTCCCGGCGTCTGGGGTTCCGGCAAGCCTCTTCCTCACGAGGGCGGCAGA
CAACTGACGTACTTTTGCAACGCCTACGCCAGCCTATACTTGACTCTCGCCGTCCTCGCCGTCTTACACTTCTCC
GGCCTCTGGCCACTGTATCTTGCTCTCGATCACTTTGGCCCTCTGCTGTCCGTCGCCATCATCAGTGGCTTCCTC
GTCAGCGTCGTCGCCTACGTCTCGGCCATATACAGGGGCAAGCAGCACCGCATGACGGGTCATGTCATCTACGAC
TTCTTCATGGGCGCCGAGCTCAACCCGCGCATGTTTGGCATCCTCGACTTCAAGATGTTTTGCGAGGTCCGCATG
CCTTGGTACATGCTGCTCATCCTCAGCCTCGGCGCTGCCGCCCGTCAGTACGACCGCTACGGCTACGTCTCCGCT
GAAGTGCTCTTCCTCGTCATGGCTCACTACCTCTACGCCAACGCCTGCGCCAAGGGAGAGGAGCTCATCGTCACC
ACCTGGGACATGTACTACGAGAAATGGGGCTTCATGCTCATCTTCTGGAACCTCGCCGGCGTCCCGCTCTCGTAC
TGCCACTGCACCATCTACCTCGCTAACCACGACCCGTCCGAGTACCGCTGGAACCGCTGGGCCTTGGCTGCCCTC
TACCTCGCCTACCTCTTCTGGTACTGGGTCTGGGACAGCTGCAACAGTCAGAAGAACCGTTTCCGCGCCATGGAG
AGCGGCCGTCTCATCAGCCGCAACACCTTCCCCCAGGTGCCGTGGCAGACGCTCCACGAACCCGAGACGATCGTG
TCGCCGCAGGGCACCATCCTCGTTGACGGATGGTACGGCCTGGCGCGCAAGATTCACTACACCGCCGACGTCTGG
TTCGCCCTCTCGTGGGGGCTGATAACGGGCTTCAAGAGCCCGTTCCCGTGGTTCTATCCCGTCTTCTTTTGCTGC
ATGATCGCTCACCGCGCCTCGCGAGACATCCATCGCTGTCGCATCAAGTACGGCGATGCCTGGCTCGAGTACGAG
CGAAGAGTCCCATATCTGTTCATTCCCTACGTCATATAG
Transcript >Ophcf2|00731
ATGTCGAGATACTCGCTGCGCCAGAACCCGAGAAAGATGGTCATAGAAGGCATGGTCCCGACGCCAGGAACGCGT
CGCCAATCGCGTCGCAAGCCCTCTTTCCCGCTCGAAGATGTCGACAATGACTCGAGCTCGGCGGCTGAGACGTCG
ACGCGTGCCCGTTCCCTTCGCAGCCGCCGTACGGCCTCTCGACAGAAGGCCGAGGATGATACTGGCGAGGACGAT
GGCTTGTCCAATGGCACCAGGACAGATACAGGCGCGTCCGACGACACTCCGACGCGGCCCAGGAAGCGCGTCGTC
TCTTCACGAACGAAGCCGGCGGAACGCGTCGTCGACGGCTGGAAGCCCGGCCAGGACCCCAAGCTCGACCTCTCT
GGCGAATTCGAGTTCGGAGGCTCGATAGGGACGGCTACCATGATGTTGCTCTTCCCCCTTCTCATGTGGTATATG
TGGATCGGAGCCACATACTTCGACGGCAAGCTTCCCGTCCCCACGCCCGACCAGACCTGGCTCCAGTTCGGCGCA
GAGATGGCCGGTCTCGTCTACGCCGGCGCGTTCCCTCATGCCGCCGCCTGGTTCTGGTACTGGTCATATCTCGCC
TTTCAGGCCGCCTGTTACTGTCTGCTTCCCGGCGTCTGGGGTTCCGGCAAGCCTCTTCCTCACGAGGGCGGCAGA
CAACTGACGTACTTTTGCAACGCCTACGCCAGCCTATACTTGACTCTCGCCGTCCTCGCCGTCTTACACTTCTCC
GGCCTCTGGCCACTGTATCTTGCTCTCGATCACTTTGGCCCTCTGCTGTCCGTCGCCATCATCAGTGGCTTCCTC
GTCAGCGTCGTCGCCTACGTCTCGGCCATATACAGGGGCAAGCAGCACCGCATGACGGGTCATGTCATCTACGAC
TTCTTCATGGGCGCCGAGCTCAACCCGCGCATGTTTGGCATCCTCGACTTCAAGATGTTTTGCGAGGTCCGCATG
CCTTGGTACATGCTGCTCATCCTCAGCCTCGGCGCTGCCGCCCGTCAGTACGACCGCTACGGCTACGTCTCCGCT
GAAGTGCTCTTCCTCGTCATGGCTCACTACCTCTACGCCAACGCCTGCGCCAAGGGAGAGGAGCTCATCGTCACC
ACCTGGGACATGTACTACGAGAAATGGGGCTTCATGCTCATCTTCTGGAACCTCGCCGGCGTCCCGCTCTCGTAC
TGCCACTGCACCATCTACCTCGCTAACCACGACCCGTCCGAGTACCGCTGGAACCGCTGGGCCTTGGCTGCCCTC
TACCTCGCCTACCTCTTCTGGTACTGGGTCTGGGACAGCTGCAACAGTCAGAAGAACCGTTTCCGCGCCATGGAG
AGCGGCCGTCTCATCAGCCGCAACACCTTCCCCCAGGTGCCGTGGCAGACGCTCCACGAACCCGAGACGATCGTG
TCGCCGCAGGGCACCATCCTCGTTGACGGATGGTACGGCCTGGCGCGCAAGATTCACTACACCGCCGACGTCTGG
TTCGCCCTCTCGTGGGGGCTGATAACGGGCTTCAAGAGCCCGTTCCCGTGGTTCTATCCCGTCTTCTTTTGCTGC
ATGATCGCTCACCGCGCCTCGCGAGACATCCATCGCTGTCGCATCAAGTACGGCGATGCCTGGCTCGAGTACGAG
CGAAGAGTCCCATATCTGTTCATTCCCTACGTCATATAG
Gene >Ophcf2|00731
ATGTCGAGATACTCGCTGCGCCAGAACCCGAGGTAATGCGGTCAACAGACCATATATGGCGCGTCTGACGCTTTC
TCTAGAAAGATGGTCATAGAAGGCATGGTCCCGACGCCAGGAACGCGTCGCCAATCGCGTCGCAAGCCCTCTTTC
CCGCTCGAAGATGTCGACAATGACTCGAGCTCGGCGGCTGAGACGTCGACGCGTGCCCGTTCCCTTCGCAGCCGC
CGTACGGCCTCTCGACAGAAGGCCGAGGATGATACTGGCGAGGACGATGGCTTGTCCAATGGCACCAGGACAGAT
ACAGGCGCGTCCGACGACACTCCGACGCGGCCCAGGAAGCGCGTCGTCTCTTCACGAACGAAGCCGGCGGAACGC
GTCGTCGACGGCTGGAAGCCCGGCCAGGACCCCAAGCTCGACCTCTCTGGCGAATTCGAGTTCGGAGGCTCGATA
GGGACGGCTACCATGATGTTGCTCTTCCCCCTTCTCATGTGGTATATGTGGATCGGAGCCACATACTTCGACGGC
AAGCTTCCCGTCCCCACGCCCGACCAGACCTGGCTCCAGTTCGGCGCAGAGATGGCCGGTCTCGTCTACGCCGGC
GCGTTCCCTCATGCCGCCGCCTGGTTCTGGTACTGGTCATATCTCGCCTTTCAGGCCGCCTGTTACTGTCTGCTT
CCCGGCGTCTGGGGTTCCGGCAAGCCTCTTCCTCACGAGGGCGGCAGACAACTGACGTACTTTTGCAACGCCTAC
GCCAGCCTATACTTGACTCTCGCCGTCCTCGCCGTCTTACACTTCTCCGGCCTCTGGCCACTGTATCTTGCTCTC
GATCACTTTGGCCCTCTGCTGTCCGTCGCCATCATCAGTGGCTTCCTCGTCAGCGTCGTCGCCTACGTCTCGGCC
ATATACAGGGGCAAGCAGCACCGCATGACGGGTCATGTCATCTACGACTTCTTCATGGGCGCCGAGCTCAACCCG
CGCATGTTTGGCATCCTCGACTTCAAGATGTTTTGCGAGGTCCGCATGCCTTGGTACATGCTGCTCATCCTCAGC
CTCGGCGCTGCCGCCCGTCAGTACGACCGCTACGGCTACGTCTCCGCTGAAGTGCTCTTCCTCGTCATGGCTCAC
TACCTCTACGCCAACGCCTGCGCCAAGGGAGAGGAGCTCATCGTCACCACCTGGTGAGCCGTTCCCTCTCCTGCC
TCGCACATATCAGGGCTGACATGCTCGCCAGGGACATGTACTACGAGAAATGGGGCTTCATGCTCATCTTCTGGA
ACCTCGCCGGCGTCCCGCTCTCGTACTGCCACTGCACCATCTACCTCGCTAACCACGACCCGTCCGAGTACCGCT
GGAACCGCTGGGCCTTGGCTGCCCTCTACCTCGCCTACCTCTTCTGGTACTGGGTCTGGGACAGCTGCAACAGTC
AGAAGAACCGTTTCCGCGCCATGGAGAGCGGCCGTCTCATCAGCCGCAACACCTTCCCCCAGGTGCCGTGGCAGA
CGCTCCACGAACCCGAGACGATCGTGTCGCCGCAGGGCACCATCCTCGTTGACGGATGGTACGGCCTGGCGCGCA
AGATTCACTACACCGCCGACGTCTGGTTCGCCCTCTCGTGGGGGCTGATAACGGGCTTCAAGTGTGTAGTCTTCC
CTTTTAGTTTTCCTCCGTCCAGCTCGCTAAAGCTTTGGCACCGATAGGAGCCCGTTCCCGTGGTTCTATCCCGTC
TTCTTTTGCTGCATGATCGCTCACCGCGCCTCGCGAGACATCCATCGCTGTCGCATCAAGTACGGCGATGCCTGG
CTCGAGTACGAGCGAAGAGTCCCATATCTGTTCATTCCCGTGAGTTCAAGTCCTCCTCGACAAGACGTATCCCCT
GATCATGGTGCTGAAATCCCTTCCACTTTCATGCAGTACGTCATATAG

© 2022 - Robin Ohm - Utrecht University - The Netherlands

Built with Python Django and Wagtail