Fungal Genomics

at Utrecht University

General Properties

Protein IDOphcf2|00730
Gene name
Locationscaffold_01:2738004..2743413
Strand-
Gene length (bp)5409
Transcript length (bp)5343
Coding sequence length (bp)5343
Protein length (aa) 1781

Overview

Your browser does not support drawing a protein figure.

PFAM Domains

PFAM Domain ID Short name Long name E-value Start End
PF00614 PLDc Phospholipase D Active site motif 2.0E-07 885 911
PF00614 PLDc Phospholipase D Active site motif 1.1E-06 1193 1215

GO

GO Term Description Terminal node
GO:0003824 catalytic activity Yes
GO:0003674 molecular_function No

Deeploc

[Help with interpreting the results of Deeploc 2.0]
Localizations Signals Cytoplasm Nucleus Extracellular Cell membrane Mitochondrion Plastid Endoplasmic reticulum Lysosome vacuole Golgi apparatus Peroxisome
Cytoplasm Nuclear localization signal 0.603 0.3333 0.1156 0.33 0.1502 0.0365 0.2211 0.2959 0.2099 0.0164

SignalP

(None)

Transmembrane Domains

(None)

Transcription Factor Class

(None)

CAZymes

(None)

Secondary Metabolism

(None)

Expression data

Analysis 1: Expression analysis during behavioral modification. Published in: Will et al., G3, 2020

Click here for more information

Orthologs

Orthofinder run ID4
Orthogroup1092
Change Orthofinder run
Species Protein ID
Ophiocordyceps australis 1348a (Ghana) OphauG2|4094
Ophiocordyceps australis map64 (Brazil) OphauB2|1994
Ophiocordyceps camponoti-floridani Ophcf2|00730 (this protein)
Ophiocordyceps camponoti-rufipedis Ophun1|2692
Ophiocordyceps kimflemingae Ophio5|2744
Ophiocordyceps subramaniannii Hirsu2|10097

Sequences

Type of sequenceSequence
Locus Download genbank file of locus Download genbank file of locus (reverse complement)
The gene with 5 kb flanks (if sufficient flanking sequence is available). For use in cloning design programs. NOTE: features (genes or exons) that are only partially contained within the sequence are completely excluded.
Protein >Ophcf2|00730
MAGDDDDSVSPGTRSPRSPGPRHASPRPDGEASDYWNGGLKHREISPKITSDGSGLRFSHVVANEADETLSSLSS
PDAMAVSGRRSVQFVRPDVADPPSVTSSHTQHARHSSWDTQDTPSRSRSASFISKIRAFASNPNLQTTKPQAPAS
TPMENGSPSMPTSPTFNRLGSRLPDTLTEEQSDADADIEETADEASCPQQEPSKKRKKRKMRRFKKGQLSPSTTT
SGRPGEMDTADTYSRLLRRRASMPDASIHATIMSDGDGRDQPSRRRPFRRGHSYAEAAPRDDDNEEAVVPRSGHQ
RRITVFGGGGVSDGDAISPKRPFFTSERASNFGAQKWKQVKSTLKLLRQKKEDRFDYFKSAELMAELRAGAPAVL
MLASMIQRDEHGNKRIPVLLEQLKLRIKDSCPIPDDDRERHWIFTFELEYGSGPSRMSWTVVRNIRDIYNLHFRY
KFALGNDKYMPGRSDLGARPRQPKFPYSAFPYLRRARIKGDDSDEEDQVSARGEETAGEGTAGEGTAGEGTAGEG
ATDEGQPQPLRRKSRANLWGMRRRSTGHTDPGDASNAEGGTQSNAALDMMSRRQRYVEKQRRTLEKYLSEMIRWL
MFRADSNRLCRFLELSALGVRLAAEGSYHGKEGFLHIQSSKGLDFRRVLTPAKVIARHSRKWFLVRQSYIVCVES
PENMNIYDVYLVDSKFSIVSKRNPLKKMATKQADIDLTVETPRDKHHTLTLCTSERKVRLFSSYQSVMRQFEESI
NEMLRQTPWYEKKRFGSFAPVRTGVFAQWLVDGRDYMWNVSRAINMARDVIYIHDWWLSPELYMRRPACISQKWR
LDRLLQKKAREGVKIFVIIYRNVEAAIPIDSEYTKSSLLNLHPNIFVQRSPNQFKKNQFFFAHHEKICIVDHDVA
FLGGIDLCFGRWDCPQHPIVDDKPTGFEMSERPKDAEHCQLFPGKDYSNPRVQDFFRLNEPYEEMYDRSKVPRMP
WHDVSMQVVGQPARDLTRHFIQRWNYLRRGRKPTRPLPFLLPPPDARLDEVEALGLTGTCEVQMLRSAAAWSLGI
EETEHSIQTAYVRMIEESEHFIYMENQFFITSTEAYNTKIVNRIGDALVERIIRARDNGETWRCAIVIPLMPGFQ
NTVDEQEGTSVRLIVMCQYRSICRGEHSIFGRLRAAGIDPEEYIGFYSLRQWGVMGNDALVTEQLYIHAKTIIVD
DRVALIGSANINERSMLGTRDSECAALVRDTDMIWSKMAGKPYQVGRFAHTLRLRLMREHLGLDVDEILEEERQH
EMDRDAFEREMGQIYGDDKKPASSAVAGPSTDRGRRLSTILRLPSFNHDADEQATPDVDNDASSRGKEASTDSRV
AGKKHQMDVSGYGPDRWKSAQEAGLDGGRDSVIVNGREVLVQSVDSNGKGALDCPKWPTDHLSAAGSRRQESPEG
HDGMPPVPPLSRRGTEQLGLPRAAQLAPLPVTDDTDIGGPPVHIDPLTGRPTQSACHPMAADIYAADIGKDCMRD
PVDPGFMDEVWNRVAKNNTKLYRRVFRCMPDSEVSTWTEYREYMDYSERLRAAMEGKAPGETSELKSETSHGKEA
TAGGAGISAPGPEAIAKAARKEVRKASDKLSEKMAADAEKTPTTEGGEAQLSEKMPLRSAGSEPLLGATLGGGAE
TPTLLPLHSAHATFPALETGPSRERKTATFNPGDNNGGSSSNNNNNNNNNNNGPPSKEAGSIKRRRRATTKGSKR
GLSMEEMPSRSDAEELLKMIQGNLVQFPYDWLLTEEQNGNWGYQVDGVAPLAIYD*
Coding >Ophcf2|00730
ATGGCTGGAGACGACGACGATTCCGTGTCTCCCGGCACGCGGAGCCCCCGGTCTCCCGGCCCTCGACATGCGTCA
CCACGTCCCGACGGCGAGGCCAGCGACTATTGGAACGGCGGCCTCAAGCACCGTGAAATATCCCCCAAGATCACC
TCGGACGGTTCGGGGTTGCGCTTCAGTCATGTCGTCGCCAACGAGGCTGACGAGACTCTGTCTTCCCTCAGCTCG
CCCGATGCCATGGCTGTCTCGGGCAGACGGAGCGTCCAGTTTGTGAGGCCAGACGTGGCGGACCCGCCGAGTGTC
ACAAGCTCCCATACCCAGCATGCCCGACACAGCTCGTGGGATACCCAGGACACTCCTTCGAGGTCCCGAAGCGCT
TCCTTCATTTCCAAGATCCGGGCTTTCGCGAGCAACCCCAACCTTCAGACGACCAAGCCACAGGCTCCGGCCTCG
ACACCCATGGAAAATGGGTCGCCCTCGATGCCCACCTCGCCCACCTTCAACCGGCTGGGCTCTCGGCTACCGGAC
ACGCTCACCGAGGAGCAGTCGGATGCCGACGCAGACATCGAGGAGACGGCCGACGAGGCCTCTTGTCCCCAGCAG
GAACCGTCCAAGAAAAGAAAGAAGCGCAAGATGCGACGGTTCAAAAAGGGGCAGCTGTCACCGTCGACGACGACC
AGTGGTCGGCCGGGAGAGATGGATACCGCCGACACGTACAGCAGGCTACTGAGACGCCGCGCCAGCATGCCCGAC
GCCTCGATCCACGCCACCATCATGTCCGACGGCGACGGGCGTGATCAGCCGTCGAGACGCAGGCCCTTCCGCAGG
GGCCACTCGTACGCCGAGGCAGCTCCGAGGGACGACGACAACGAAGAGGCCGTCGTACCGAGATCGGGCCACCAG
CGGCGCATCACCGTCTTCGGTGGAGGCGGCGTGTCCGACGGTGACGCCATCTCTCCCAAGCGGCCCTTCTTCACG
TCGGAGCGGGCTTCTAACTTTGGCGCTCAGAAGTGGAAACAGGTCAAGAGTACGCTGAAGCTGCTGCGACAGAAG
AAGGAAGACCGGTTCGACTACTTCAAGTCGGCCGAGCTCATGGCCGAGCTGAGAGCCGGTGCGCCGGCCGTCCTG
ATGCTGGCGAGCATGATCCAGCGGGACGAGCATGGGAATAAGAGGATCCCTGTTCTCCTGGAGCAGCTCAAGCTG
AGGATCAAGGACAGCTGCCCCATCCCGGACGACGACCGGGAGAGGCACTGGATCTTTACATTTGAGCTCGAGTAC
GGCAGCGGGCCCAGCCGGATGAGCTGGACCGTCGTTCGCAACATCCGCGACATCTACAACCTGCACTTCCGCTAC
AAGTTTGCCCTCGGCAACGACAAGTACATGCCGGGCCGCTCCGACCTCGGGGCGCGTCCGAGGCAGCCCAAGTTC
CCCTACTCGGCCTTTCCCTACCTGCGGCGGGCGCGGATCAAGGGCGACGACAGCGATGAGGAGGATCAGGTCAGC
GCCCGTGGCGAGGAGACGGCGGGCGAGGGCACGGCGGGCGAGGGCACAGCCGGAGAGGGCACAGCCGGCGAAGGG
GCCACCGACGAGGGCCAGCCGCAGCCGCTGCGCAGAAAGTCGCGTGCCAACCTCTGGGGCATGAGACGCCGTTCG
ACCGGCCACACGGATCCGGGCGACGCCTCCAATGCCGAGGGGGGGACTCAGTCCAACGCGGCGCTCGACATGATG
AGCCGCAGACAGCGCTACGTCGAGAAGCAGAGGCGGACGCTGGAAAAGTATCTCTCCGAGATGATTCGCTGGCTC
ATGTTCCGCGCCGACAGCAACCGTCTGTGCCGCTTCCTCGAGCTGTCGGCTCTAGGCGTGCGCCTCGCGGCCGAG
GGCAGCTATCACGGAAAGGAGGGCTTCCTGCACATCCAGTCGTCCAAGGGCCTGGACTTTCGACGCGTCCTGACG
CCGGCAAAGGTCATTGCCCGACATAGCCGCAAGTGGTTCCTCGTCCGGCAGAGCTACATCGTGTGTGTCGAGTCG
CCCGAGAATATGAACATCTACGACGTCTACCTGGTCGACTCCAAGTTCAGCATCGTGTCGAAGCGCAACCCTCTC
AAGAAGATGGCGACGAAGCAGGCCGACATCGATCTGACGGTCGAGACACCGCGCGACAAGCATCACACGCTGACG
CTGTGCACGTCGGAGCGCAAGGTCCGGCTCTTCTCCAGCTACCAGTCGGTGATGCGACAGTTTGAGGAGTCCATC
AACGAGATGCTCAGACAGACGCCCTGGTACGAGAAGAAGCGCTTCGGGAGCTTCGCCCCGGTCCGTACCGGCGTC
TTCGCCCAGTGGCTCGTCGACGGCAGAGACTACATGTGGAACGTATCGAGAGCCATCAACATGGCCCGAGACGTC
ATCTACATCCACGACTGGTGGCTGAGTCCCGAGCTGTACATGCGAAGGCCGGCTTGTATCAGCCAGAAGTGGCGC
CTGGATCGGCTTCTGCAGAAGAAGGCTCGCGAGGGCGTCAAGATCTTCGTCATCATCTATCGCAACGTCGAGGCC
GCCATACCCATCGACTCCGAGTACACAAAGTCCTCGCTGTTGAACCTGCATCCCAACATCTTCGTCCAGAGGTCT
CCCAATCAGTTCAAGAAGAATCAGTTCTTCTTCGCCCATCATGAGAAGATATGCATCGTCGACCATGACGTCGCC
TTCCTCGGCGGCATCGATCTCTGCTTCGGCCGATGGGACTGTCCGCAGCATCCCATCGTCGACGACAAGCCGACC
GGCTTCGAGATGTCGGAGCGGCCCAAGGACGCCGAGCACTGCCAGCTGTTCCCGGGCAAGGACTACTCCAACCCC
CGCGTCCAGGACTTCTTCCGCCTCAACGAGCCCTACGAGGAGATGTACGACCGCAGCAAGGTGCCTCGTATGCCC
TGGCACGACGTCAGCATGCAAGTCGTCGGCCAGCCGGCTCGCGATCTGACGCGGCACTTTATCCAGCGATGGAAC
TACCTCCGCCGAGGCCGGAAACCGACGCGGCCGCTGCCCTTCTTGCTGCCGCCTCCGGACGCCCGGCTGGACGAG
GTGGAAGCACTCGGCCTCACGGGCACCTGCGAAGTCCAGATGCTGCGGTCCGCCGCCGCCTGGTCGCTGGGCATC
GAGGAGACGGAGCACAGCATCCAGACGGCCTACGTCAGGATGATTGAGGAGTCGGAGCACTTCATCTACATGGAG
AACCAGTTCTTCATCACGAGCACCGAGGCGTACAACACCAAGATCGTCAACCGCATCGGCGACGCACTCGTGGAG
CGTATCATCCGCGCGCGTGACAACGGCGAGACGTGGCGCTGCGCCATCGTCATCCCCCTGATGCCCGGCTTCCAG
AACACGGTCGACGAGCAGGAGGGGACCAGCGTCCGGCTCATCGTCATGTGTCAGTACCGCAGCATCTGTCGAGGA
GAGCACTCCATCTTTGGCCGTCTGCGGGCTGCAGGCATCGACCCCGAGGAGTATATCGGCTTCTACTCGCTGCGG
CAGTGGGGAGTCATGGGAAACGATGCCCTCGTTACGGAGCAGCTGTACATACACGCCAAGACCATCATCGTCGAC
GACCGCGTCGCTCTCATCGGCTCCGCCAATATCAACGAACGCTCCATGCTGGGCACCAGAGACTCCGAGTGCGCG
GCCCTCGTGCGGGATACGGACATGATTTGGTCCAAGATGGCCGGAAAGCCCTACCAGGTCGGCCGATTCGCCCAC
ACGCTGCGTCTGCGTCTGATGCGGGAGCACCTCGGCCTCGACGTCGACGAGATCTTGGAGGAGGAACGACAGCAC
GAGATGGACCGTGACGCTTTTGAACGGGAGATGGGACAGATTTACGGCGACGACAAGAAGCCGGCTTCTTCGGCC
GTCGCGGGACCCAGCACGGACCGCGGCCGACGGCTCAGCACCATCCTCCGGCTGCCCAGCTTCAACCACGACGCC
GACGAGCAAGCGACCCCAGACGTGGATAACGATGCTTCCAGCAGAGGCAAAGAAGCTTCGACTGATTCCAGGGTC
GCAGGCAAGAAGCACCAGATGGACGTATCCGGCTACGGGCCGGATCGCTGGAAGAGTGCCCAAGAGGCGGGCCTC
GACGGGGGTCGCGATTCCGTCATCGTCAACGGCCGAGAGGTGCTGGTACAGAGCGTCGACAGCAACGGCAAGGGA
GCCCTAGACTGCCCGAAATGGCCGACCGACCACCTGTCGGCCGCGGGAAGCCGGCGCCAGGAGTCCCCCGAAGGC
CACGACGGGATGCCCCCCGTACCGCCGCTGAGTCGGCGTGGCACGGAGCAACTCGGGTTGCCTCGAGCCGCCCAG
CTAGCCCCTCTGCCCGTGACGGACGACACGGATATTGGGGGCCCGCCCGTCCACATAGATCCCCTGACGGGCCGT
CCGACGCAGAGCGCCTGTCATCCCATGGCGGCCGATATTTACGCGGCCGACATCGGCAAGGACTGCATGCGTGAT
CCCGTCGACCCGGGCTTCATGGATGAGGTCTGGAACCGGGTGGCCAAGAACAACACCAAGCTCTACCGCAGAGTC
TTTCGCTGCATGCCGGATTCAGAGGTGAGCACGTGGACCGAGTACCGCGAGTACATGGATTACAGCGAGAGGCTC
CGAGCCGCCATGGAGGGCAAGGCTCCGGGCGAGACGAGCGAGCTCAAGAGCGAGACCAGCCACGGTAAGGAGGCG
ACGGCGGGAGGAGCCGGAATCAGCGCGCCGGGGCCCGAAGCCATAGCCAAGGCGGCCCGGAAAGAAGTGCGCAAG
GCGTCAGACAAGTTGTCGGAGAAGATGGCCGCCGACGCGGAGAAGACGCCGACGACCGAGGGCGGAGAGGCGCAG
TTGAGCGAAAAGATGCCCCTGCGCAGCGCGGGCTCGGAGCCGCTCCTGGGCGCGACGTTGGGCGGAGGAGCGGAG
ACGCCGACGTTGCTCCCGTTACATTCGGCGCACGCTACGTTTCCCGCTTTGGAGACGGGGCCGAGCCGTGAGCGC
AAGACGGCGACCTTTAACCCCGGCGATAACAACGGCGGCAGCAGCAGCAACAACAACAACAACAACAACAACAAC
AACAACGGGCCGCCGTCCAAAGAGGCTGGATCCATCAAGCGCCGGCGCCGGGCCACTACCAAAGGCAGCAAGCGC
GGTCTTTCGATGGAGGAGATGCCGTCGCGGTCTGACGCCGAGGAGCTGCTCAAGATGATCCAGGGCAATCTGGTG
CAGTTCCCGTACGACTGGCTGCTGACGGAGGAGCAGAACGGGAACTGGGGCTATCAAGTGGACGGCGTAGCCCCG
CTGGCCATCTATGATTGA
Transcript >Ophcf2|00730
ATGGCTGGAGACGACGACGATTCCGTGTCTCCCGGCACGCGGAGCCCCCGGTCTCCCGGCCCTCGACATGCGTCA
CCACGTCCCGACGGCGAGGCCAGCGACTATTGGAACGGCGGCCTCAAGCACCGTGAAATATCCCCCAAGATCACC
TCGGACGGTTCGGGGTTGCGCTTCAGTCATGTCGTCGCCAACGAGGCTGACGAGACTCTGTCTTCCCTCAGCTCG
CCCGATGCCATGGCTGTCTCGGGCAGACGGAGCGTCCAGTTTGTGAGGCCAGACGTGGCGGACCCGCCGAGTGTC
ACAAGCTCCCATACCCAGCATGCCCGACACAGCTCGTGGGATACCCAGGACACTCCTTCGAGGTCCCGAAGCGCT
TCCTTCATTTCCAAGATCCGGGCTTTCGCGAGCAACCCCAACCTTCAGACGACCAAGCCACAGGCTCCGGCCTCG
ACACCCATGGAAAATGGGTCGCCCTCGATGCCCACCTCGCCCACCTTCAACCGGCTGGGCTCTCGGCTACCGGAC
ACGCTCACCGAGGAGCAGTCGGATGCCGACGCAGACATCGAGGAGACGGCCGACGAGGCCTCTTGTCCCCAGCAG
GAACCGTCCAAGAAAAGAAAGAAGCGCAAGATGCGACGGTTCAAAAAGGGGCAGCTGTCACCGTCGACGACGACC
AGTGGTCGGCCGGGAGAGATGGATACCGCCGACACGTACAGCAGGCTACTGAGACGCCGCGCCAGCATGCCCGAC
GCCTCGATCCACGCCACCATCATGTCCGACGGCGACGGGCGTGATCAGCCGTCGAGACGCAGGCCCTTCCGCAGG
GGCCACTCGTACGCCGAGGCAGCTCCGAGGGACGACGACAACGAAGAGGCCGTCGTACCGAGATCGGGCCACCAG
CGGCGCATCACCGTCTTCGGTGGAGGCGGCGTGTCCGACGGTGACGCCATCTCTCCCAAGCGGCCCTTCTTCACG
TCGGAGCGGGCTTCTAACTTTGGCGCTCAGAAGTGGAAACAGGTCAAGAGTACGCTGAAGCTGCTGCGACAGAAG
AAGGAAGACCGGTTCGACTACTTCAAGTCGGCCGAGCTCATGGCCGAGCTGAGAGCCGGTGCGCCGGCCGTCCTG
ATGCTGGCGAGCATGATCCAGCGGGACGAGCATGGGAATAAGAGGATCCCTGTTCTCCTGGAGCAGCTCAAGCTG
AGGATCAAGGACAGCTGCCCCATCCCGGACGACGACCGGGAGAGGCACTGGATCTTTACATTTGAGCTCGAGTAC
GGCAGCGGGCCCAGCCGGATGAGCTGGACCGTCGTTCGCAACATCCGCGACATCTACAACCTGCACTTCCGCTAC
AAGTTTGCCCTCGGCAACGACAAGTACATGCCGGGCCGCTCCGACCTCGGGGCGCGTCCGAGGCAGCCCAAGTTC
CCCTACTCGGCCTTTCCCTACCTGCGGCGGGCGCGGATCAAGGGCGACGACAGCGATGAGGAGGATCAGGTCAGC
GCCCGTGGCGAGGAGACGGCGGGCGAGGGCACGGCGGGCGAGGGCACAGCCGGAGAGGGCACAGCCGGCGAAGGG
GCCACCGACGAGGGCCAGCCGCAGCCGCTGCGCAGAAAGTCGCGTGCCAACCTCTGGGGCATGAGACGCCGTTCG
ACCGGCCACACGGATCCGGGCGACGCCTCCAATGCCGAGGGGGGGACTCAGTCCAACGCGGCGCTCGACATGATG
AGCCGCAGACAGCGCTACGTCGAGAAGCAGAGGCGGACGCTGGAAAAGTATCTCTCCGAGATGATTCGCTGGCTC
ATGTTCCGCGCCGACAGCAACCGTCTGTGCCGCTTCCTCGAGCTGTCGGCTCTAGGCGTGCGCCTCGCGGCCGAG
GGCAGCTATCACGGAAAGGAGGGCTTCCTGCACATCCAGTCGTCCAAGGGCCTGGACTTTCGACGCGTCCTGACG
CCGGCAAAGGTCATTGCCCGACATAGCCGCAAGTGGTTCCTCGTCCGGCAGAGCTACATCGTGTGTGTCGAGTCG
CCCGAGAATATGAACATCTACGACGTCTACCTGGTCGACTCCAAGTTCAGCATCGTGTCGAAGCGCAACCCTCTC
AAGAAGATGGCGACGAAGCAGGCCGACATCGATCTGACGGTCGAGACACCGCGCGACAAGCATCACACGCTGACG
CTGTGCACGTCGGAGCGCAAGGTCCGGCTCTTCTCCAGCTACCAGTCGGTGATGCGACAGTTTGAGGAGTCCATC
AACGAGATGCTCAGACAGACGCCCTGGTACGAGAAGAAGCGCTTCGGGAGCTTCGCCCCGGTCCGTACCGGCGTC
TTCGCCCAGTGGCTCGTCGACGGCAGAGACTACATGTGGAACGTATCGAGAGCCATCAACATGGCCCGAGACGTC
ATCTACATCCACGACTGGTGGCTGAGTCCCGAGCTGTACATGCGAAGGCCGGCTTGTATCAGCCAGAAGTGGCGC
CTGGATCGGCTTCTGCAGAAGAAGGCTCGCGAGGGCGTCAAGATCTTCGTCATCATCTATCGCAACGTCGAGGCC
GCCATACCCATCGACTCCGAGTACACAAAGTCCTCGCTGTTGAACCTGCATCCCAACATCTTCGTCCAGAGGTCT
CCCAATCAGTTCAAGAAGAATCAGTTCTTCTTCGCCCATCATGAGAAGATATGCATCGTCGACCATGACGTCGCC
TTCCTCGGCGGCATCGATCTCTGCTTCGGCCGATGGGACTGTCCGCAGCATCCCATCGTCGACGACAAGCCGACC
GGCTTCGAGATGTCGGAGCGGCCCAAGGACGCCGAGCACTGCCAGCTGTTCCCGGGCAAGGACTACTCCAACCCC
CGCGTCCAGGACTTCTTCCGCCTCAACGAGCCCTACGAGGAGATGTACGACCGCAGCAAGGTGCCTCGTATGCCC
TGGCACGACGTCAGCATGCAAGTCGTCGGCCAGCCGGCTCGCGATCTGACGCGGCACTTTATCCAGCGATGGAAC
TACCTCCGCCGAGGCCGGAAACCGACGCGGCCGCTGCCCTTCTTGCTGCCGCCTCCGGACGCCCGGCTGGACGAG
GTGGAAGCACTCGGCCTCACGGGCACCTGCGAAGTCCAGATGCTGCGGTCCGCCGCCGCCTGGTCGCTGGGCATC
GAGGAGACGGAGCACAGCATCCAGACGGCCTACGTCAGGATGATTGAGGAGTCGGAGCACTTCATCTACATGGAG
AACCAGTTCTTCATCACGAGCACCGAGGCGTACAACACCAAGATCGTCAACCGCATCGGCGACGCACTCGTGGAG
CGTATCATCCGCGCGCGTGACAACGGCGAGACGTGGCGCTGCGCCATCGTCATCCCCCTGATGCCCGGCTTCCAG
AACACGGTCGACGAGCAGGAGGGGACCAGCGTCCGGCTCATCGTCATGTGTCAGTACCGCAGCATCTGTCGAGGA
GAGCACTCCATCTTTGGCCGTCTGCGGGCTGCAGGCATCGACCCCGAGGAGTATATCGGCTTCTACTCGCTGCGG
CAGTGGGGAGTCATGGGAAACGATGCCCTCGTTACGGAGCAGCTGTACATACACGCCAAGACCATCATCGTCGAC
GACCGCGTCGCTCTCATCGGCTCCGCCAATATCAACGAACGCTCCATGCTGGGCACCAGAGACTCCGAGTGCGCG
GCCCTCGTGCGGGATACGGACATGATTTGGTCCAAGATGGCCGGAAAGCCCTACCAGGTCGGCCGATTCGCCCAC
ACGCTGCGTCTGCGTCTGATGCGGGAGCACCTCGGCCTCGACGTCGACGAGATCTTGGAGGAGGAACGACAGCAC
GAGATGGACCGTGACGCTTTTGAACGGGAGATGGGACAGATTTACGGCGACGACAAGAAGCCGGCTTCTTCGGCC
GTCGCGGGACCCAGCACGGACCGCGGCCGACGGCTCAGCACCATCCTCCGGCTGCCCAGCTTCAACCACGACGCC
GACGAGCAAGCGACCCCAGACGTGGATAACGATGCTTCCAGCAGAGGCAAAGAAGCTTCGACTGATTCCAGGGTC
GCAGGCAAGAAGCACCAGATGGACGTATCCGGCTACGGGCCGGATCGCTGGAAGAGTGCCCAAGAGGCGGGCCTC
GACGGGGGTCGCGATTCCGTCATCGTCAACGGCCGAGAGGTGCTGGTACAGAGCGTCGACAGCAACGGCAAGGGA
GCCCTAGACTGCCCGAAATGGCCGACCGACCACCTGTCGGCCGCGGGAAGCCGGCGCCAGGAGTCCCCCGAAGGC
CACGACGGGATGCCCCCCGTACCGCCGCTGAGTCGGCGTGGCACGGAGCAACTCGGGTTGCCTCGAGCCGCCCAG
CTAGCCCCTCTGCCCGTGACGGACGACACGGATATTGGGGGCCCGCCCGTCCACATAGATCCCCTGACGGGCCGT
CCGACGCAGAGCGCCTGTCATCCCATGGCGGCCGATATTTACGCGGCCGACATCGGCAAGGACTGCATGCGTGAT
CCCGTCGACCCGGGCTTCATGGATGAGGTCTGGAACCGGGTGGCCAAGAACAACACCAAGCTCTACCGCAGAGTC
TTTCGCTGCATGCCGGATTCAGAGGTGAGCACGTGGACCGAGTACCGCGAGTACATGGATTACAGCGAGAGGCTC
CGAGCCGCCATGGAGGGCAAGGCTCCGGGCGAGACGAGCGAGCTCAAGAGCGAGACCAGCCACGGTAAGGAGGCG
ACGGCGGGAGGAGCCGGAATCAGCGCGCCGGGGCCCGAAGCCATAGCCAAGGCGGCCCGGAAAGAAGTGCGCAAG
GCGTCAGACAAGTTGTCGGAGAAGATGGCCGCCGACGCGGAGAAGACGCCGACGACCGAGGGCGGAGAGGCGCAG
TTGAGCGAAAAGATGCCCCTGCGCAGCGCGGGCTCGGAGCCGCTCCTGGGCGCGACGTTGGGCGGAGGAGCGGAG
ACGCCGACGTTGCTCCCGTTACATTCGGCGCACGCTACGTTTCCCGCTTTGGAGACGGGGCCGAGCCGTGAGCGC
AAGACGGCGACCTTTAACCCCGGCGATAACAACGGCGGCAGCAGCAGCAACAACAACAACAACAACAACAACAAC
AACAACGGGCCGCCGTCCAAAGAGGCTGGATCCATCAAGCGCCGGCGCCGGGCCACTACCAAAGGCAGCAAGCGC
GGTCTTTCGATGGAGGAGATGCCGTCGCGGTCTGACGCCGAGGAGCTGCTCAAGATGATCCAGGGCAATCTGGTG
CAGTTCCCGTACGACTGGCTGCTGACGGAGGAGCAGAACGGGAACTGGGGCTATCAAGTGGACGGCGTAGCCCCG
CTGGCCATCTATGATTGA
Gene >Ophcf2|00730
ATGGCTGGAGACGACGACGATTCCGTGTCTCCCGGCACGCGGAGCCCCCGGTCTCCCGGCCCTCGACATGCGTCA
CCACGTCCCGACGGCGAGGCCAGCGACTATTGGAACGGCGGCCTCAAGCACCGTGAAATATCCCCCAAGATCACC
TCGGACGGTTCGGGGTTGCGCTTCAGTCATGTCGTCGCCAACGAGGCTGACGAGACTCTGTCTTCCCTCAGCTCG
CCCGATGCCATGGCTGTCTCGGGCAGACGGAGCGTCCAGTTTGTGAGGCCAGACGTGGCGGACCCGCCGAGTGTC
ACAAGCTCCCATACCCAGCATGCCCGACACAGCTCGTGGGATACCCAGGACACTCCTTCGAGGTCCCGAAGCGCT
TCCTTCATTTCCAAGATCCGGGCTTTCGCGAGCAACCCCAACCTTCAGACGACCAAGCCACAGGCTCCGGCCTCG
ACACCCATGGAAAATGGGTCGCCCTCGATGCCCACCTCGCCCACCTTCAACCGGCTGGGCTCTCGGCTACCGGAC
ACGCTCACCGAGGAGCAGTCGGATGCCGACGCAGACATCGAGGAGACGGCCGACGAGGCCTCTTGTCCCCAGCAG
GAACCGTCCAAGAAAAGAAAGAAGCGCAAGATGCGACGGTTCAAAAAGGGGCAGCTGTCACCGTCGACGACGACC
AGTGGTCGGCCGGGAGAGATGGATACCGCCGACACGTACAGCAGGCTACTGAGACGCCGCGCCAGCATGCCCGAC
GCCTCGATCCACGCCACCATCATGTCCGACGGCGACGGGCGTGATCAGCCGTCGAGACGCAGGCCCTTCCGCAGG
GGCCACTCGTACGCCGAGGCAGCTCCGAGGGACGACGACAACGAAGAGGCCGTCGTACCGAGATCGGGCCACCAG
CGGCGCATCACCGTCTTCGGTGGAGGCGGCGTGTCCGACGGTGACGCCATCTCTCCCAAGCGGCCCTTCTTCACG
TCGGAGCGGGCTTCTAACTTTGGCGCTCAGAAGTGGAAACAGGTCAAGAGTACGCTGAAGCTGCTGCGACAGAAG
AAGGAAGACCGGTTCGACTACTTCAAGTCGGCCGAGCTCATGGCCGAGCTGAGAGCCGGTGCGCCGGCCGTCCTG
ATGCTGGCGAGCATGATCCAGCGGGACGAGCATGGGAATAAGAGGATCCCTGTTCTCCTGGAGCAGCTCAAGCTG
AGGATCAAGGACAGCTGCCCCATCCCGGACGACGACCGGGAGAGGCACTGGATCTTTACATTTGAGCTCGAGTAC
GGCAGCGGGCCCAGCCGGATGAGCTGGACCGTCGTTCGCAACATCCGCGACATCTACAACCTGCACTTCCGCTAC
AAGTTTGCCCTCGGCAACGACAAGTACATGCCGGGCCGCTCCGACCTCGGGGCGCGTCCGAGGCAGCCCAAGTTC
CCCTACTCGGCCTTTCCCTACCTGCGGCGGGCGCGGATCAAGGGCGACGACAGCGATGAGGAGGATCAGGTCAGC
GCCCGTGGCGAGGAGACGGCGGGCGAGGGCACGGCGGGCGAGGGCACAGCCGGAGAGGGCACAGCCGGCGAAGGG
GCCACCGACGAGGGCCAGCCGCAGCCGCTGCGCAGAAAGTCGCGTGCCAACCTCTGGGGCATGAGACGCCGTTCG
ACCGGCCACACGGATCCGGGCGACGCCTCCAATGCCGAGGGGGGGACTCAGTCCAACGCGGCGCTCGACATGATG
AGCCGCAGACAGCGCTACGTCGAGAAGCAGAGGCGGACGCTGGAAAAGTATCTCTCCGAGATGATTCGCTGGCTC
ATGTTCCGCGCCGACAGCAACCGTCTGTGCCGCTTCCTCGAGCTGTCGGCTCTAGGCGTGCGCCTCGCGGCCGAG
GGCAGCTATCACGGAAAGGAGGGCTTCCTGCACATCCAGTCGTCCAAGGGCCTGGACTTTCGACGCGTCCTGACG
CCGGCAAAGGTCATTGCCCGACATAGCCGCAAGTGGTTCCTCGTCCGGCAGAGCTACATCGTGTGTGTCGAGTCG
CCCGAGAATATGAACATCTACGACGTCTACCTGGTCGACTCCAAGTTCAGCATCGTGTCGAAGCGCAACCCTCTC
AAGAAGATGGCGACGAAGCAGGCCGACATCGATCTGACGGTCGAGACACCGCGCGACAAGCATCACACGCTGACG
CTGTGCACGTCGGAGCGCAAGGTCCGGCTCTTCTCCAGCTACCAGTCGGTGATGCGACAGTTTGAGGAGTCCATC
AACGAGATGCTCAGACAGACGCCCTGGTACGAGAAGAAGCGCTTCGGGAGCTTCGCCCCGGTCCGTACCGGCGTC
TTCGCCCAGTGGCTCGTCGACGGCAGAGACTACATGTGGAACGTATCGAGAGCCATCAACATGGCCCGAGACGTC
ATCTACATCCACGACTGGTGGCTGAGTCCCGAGCTGTACATGCGAAGGCCGGCTTGTATCAGCCAGAAGTGGCGC
CTGGATCGGCTTCTGCAGAAGAAGGCTCGCGAGGGCGTCAAGATCTTCGTCATCATCTATCGCAACGTCGAGGCC
GCCATACCCATCGACTCCGAGTACACAAAGTCCTCGCTGTTGAACCTGCATCCCAACATCTTCGTCCAGAGGTCT
CCCAATCAGTTCAAGAAGAATCAGTTCTTCTTCGCCCATCATGAGAAGATATGCATCGTCGACCATGACGTCGCC
TTCCTCGGCGGCATCGATCTCTGCTTCGGCCGATGGGACTGTCCGCAGCATCCCATCGTCGACGACAAGCCGACC
GGCTTCGAGATGTCGGAGCGGCCCAAGGACGCCGAGCACTGCCAGCTGTTCCCGGGCAAGGACTACTCCAACCCC
CGCGTCCAGGACTTCTTCCGCCTCAACGAGCCCTACGAGGAGATGTACGACCGCAGCAAGGTGCCTCGTATGCCC
TGGCACGACGTCAGCATGCAAGTCGTCGGCCAGCCGGCTCGCGATCTGACGCGGCACTTTATCCAGCGATGGAAC
TACCTCCGCCGAGGCCGGAAACCGACGCGGCCGCTGCCCTTCTTGCTGCCGCCTCCGGACGCCCGGCTGGACGAG
GTGGAAGCACTCGGCCTCACGGGCACCTGCGAAGTCCAGATGCTGCGGTCCGCCGCCGCCTGGTCGCTGGGCATC
GAGGAGACGGAGCACAGCATCCAGACGGCCTACGTCAGGATGATTGAGGAGTCGGAGCACTTCATCTACATGGAG
AACCAGTTCTTCATCACGAGCACCGAGGCGTACAACACCAAGATCGTCAACCGCATCGGCGACGCACTCGTGGAG
CGTATCATCCGCGCGCGTGACAACGGCGAGACGTGGCGCTGCGCCATCGTCATCCCCCTGATGCCCGGCTTCCAG
AACACGGTCGACGAGCAGGAGGGGACCAGCGTCCGGCTCATCGTCATGTGTCAGTACCGCAGCATCTGTCGAGGA
GAGCACTCCATCTTTGGCCGTCTGCGGGCTGCAGGCATCGACCCCGAGGAGTATATCGGCTTCTACTCGCTGCGG
CAGTGGGGAGTCATGGGAAACGATGCCCTCGTTACGGAGCAGCTGTACATACACGCCAAGACCATCATCGTCGAC
GACCGCGTCGCTCTCATCGGCTCCGCCAATATCAACGAACGCTCCATGCTGGGCACCAGAGACTCCGAGTGCGCG
GCCCTCGTGCGGGATACGGACATGATTTGGTCCAAGATGGCCGGAAAGCCCTACCAGGTCGGCCGATTCGCCCAC
ACGCTGCGTCTGCGTCTGATGCGGGAGCACCTCGGCCTCGACGTCGACGAGATCTTGGAGGAGGAACGACAGCAC
GAGATGGACCGTGACGCTTTTGAACGGGAGATGGGACAGATTTACGGCGACGACAAGAAGCCGGCTTCTTCGGCC
GTCGCGGGACCCAGCACGGACCGCGGCCGACGGCTCAGCACCATCCTCCGGCTGCCCAGCTTCAACCACGACGCC
GACGAGCAAGCGACCCCAGACGTGGATAACGATGCTTCCAGCAGAGGCAAAGAAGCTTCGACTGATTCCAGGGTC
GCAGGCAAGAAGCACCAGATGGACGTATCCGGCTACGGGCCGGATCGCTGGAAGAGTGCCCAAGAGGCGGGCCTC
GACGGGGGTCGCGATTCCGTCATCGTCAACGGCCGAGAGGTGCTGGTACAGAGCGTCGACAGCAACGGCAAGGGA
GCCCTAGACTGCCCGAAATGGCCGACCGACCACCTGTCGGCCGCGGGAAGCCGGCGCCAGGAGTCCCCCGAAGGC
CACGACGGGATGCCCCCCGTACCGCCGCTGAGTCGGCGTGGCACGGAGCAACTCGGGTTGCCTCGAGCCGCCCAG
CTAGCCCCTCTGCCCGTGACGGACGACACGGATATTGGGGGCCCGCCCGTCCACATAGATCCCCTGACGGGCCGT
CCGACGCAGAGCGCCTGTCATCCCATGGCGGCCGATATTTACGCGGCCGACATCGGCAAGGACTGCATGCGTGAT
CCCGTCGACCCGGGCTTCATGGATGAGGTCTGGAACCGGGTGGCCAAGAACAACACCAAGCTCTACCGCAGAGTC
TTTCGCTGCATGCCGGATTCAGAGGTGAGCACGTGGACCGAGTACCGCGAGTACATGGATTACAGCGAGAGGCTC
CGAGCCGCCATGGAGGGCAAGGCTCCGGGCGAGACGAGCGAGCTCAAGAGCGAGACCAGCCACGGTAAGGAGGCG
ACGGCGGGAGGAGCCGGAATCAGCGCGCCGGGGCCCGAAGCCATAGCCAAGGCGGCCCGGAAAGAAGTGCGCAAG
GCGTCAGACAAGTTGTCGGAGAAGATGGCCGCCGACGCGGAGAAGACGCCGACGACCGAGGGCGGAGAGGCGCAG
TTGAGCGAAAAGATGCCCCTGCGCAGCGCGGGCTCGGAGCCGCTCCTGGGCGCGACGTTGGGCGGAGGAGCGGAG
ACGCCGACGTTGCTCCCGTTACATTCGGCGCACGCTACGTTTCCCGCTTTGGAGACGGGGCCGAGCCGTGAGCGC
AAGACGGCGACCTTTAACCCCGGCGATAACAACGGCGGCAGCAGCAGCAACAACAACAACAACAACAACAACAAC
AACAACGGGCCGCCGTCCAAAGAGGCTGGATCCATCAAGCGCCGGCGCCGGGCCACTACCAAAGGCAGCAAGCGC
GGTCTTTCGATGGAGGAGATGCCGTCGCGGTCTGACGCCGAGGAGCTGCTCAAGATGATCCAGGGCAATCTGGTG
CAGTTCCCGTACGACTGGCTGCTGACGGAGGAGCAGAACGGGAACTGGGGCTATCAAGTGGACGGCGTAGCCCCG
CTGGCCATCTAGTAGGCTCACCTTTTCTTTCTTGTTCTCTCTTTGCGACGAAGCAGATGGCTAACACGTTTGCCC
AGTGATTGA

© 2023 - Robin Ohm - Utrecht University - The Netherlands

Built with Python Django and Wagtail