Fungal Genomics

at Utrecht University

General Properties

Protein IDOphcf2|00729
Gene name
Locationscaffold_01:2736919..2737654
Strand+
Gene length (bp)735
Transcript length (bp)681
Coding sequence length (bp)681
Protein length (aa) 227

Overview

Your browser does not support drawing a protein figure.

PFAM Domains

PFAM Domain ID Short name Long name E-value Start End
PF03232 COQ7 Ubiquinone biosynthesis protein COQ7 1.9E-67 45 223

GO

GO Term Description Terminal node
GO:0004497 monooxygenase activity Yes
GO:0006744 ubiquinone biosynthetic process Yes
GO:0044283 small molecule biosynthetic process No
GO:0044237 cellular metabolic process No
GO:0009987 cellular process No
GO:0008152 metabolic process No
GO:0009058 biosynthetic process No
GO:1901576 organic substance biosynthetic process No
GO:0016491 oxidoreductase activity No
GO:1901661 quinone metabolic process No
GO:0042181 ketone biosynthetic process No
GO:0003824 catalytic activity No
GO:0071704 organic substance metabolic process No
GO:0044281 small molecule metabolic process No
GO:0006743 ubiquinone metabolic process No
GO:0042180 cellular ketone metabolic process No
GO:0003674 molecular_function No
GO:1901663 quinone biosynthetic process No
GO:0044249 cellular biosynthetic process No
GO:0008150 biological_process No

Deeploc

[Help with interpreting the results of Deeploc 2.0]
Localizations Signals Cytoplasm Nucleus Extracellular Cell membrane Mitochondrion Plastid Endoplasmic reticulum Lysosome vacuole Golgi apparatus Peroxisome
Mitochondrion Mitochondrial transit peptide 0.1765 0.1079 0.0401 0.0693 0.9617 0.0495 0.0817 0.0519 0.087 0.0339

SignalP

(None)

Transmembrane Domains

(None)

Transcription Factor Class

(None)

CAZymes

(None)

Secondary Metabolism

(None)

Expression data

Analysis 1: Expression analysis during behavioral modification. Published in: Will et al., G3, 2020

Click here for more information

Orthologs

Orthofinder run ID4
Orthogroup625
Change Orthofinder run
Species Protein ID
Ophiocordyceps australis 1348a (Ghana) OphauG2|4093
Ophiocordyceps australis map64 (Brazil) OphauB2|1993
Ophiocordyceps camponoti-floridani Ophcf2|00729 (this protein)
Ophiocordyceps camponoti-rufipedis Ophun1|2691
Ophiocordyceps kimflemingae Ophio5|2743
Ophiocordyceps subramaniannii Hirsu2|10098

Sequences

Type of sequenceSequence
Locus Download genbank file of locus Download genbank file of locus (reverse complement)
The gene with 5 kb flanks (if sufficient flanking sequence is available). For use in cloning design programs. NOTE: features (genes or exons) that are only partially contained within the sequence are completely excluded.
Protein >Ophcf2|00729
MSTALSIVRRMSTRAPLGARWLSTPSTSANSPPNLKPLTDEQRQFLSSALRVNQAGELAATLIYTAQTPPIIRRH
PHLRPLMKHMYDQEAAHLTTFNALIHKHRVRPTALAPLWTVLATGLGWSTAVMGREAAMACTEAVETEIGGHYNS
QIRTLLDMISQWEQEGYDVGSELSDLVAILTRIRDEELEHLDHAVEHDAKKAEPYWLLTGIIRAGCRGAIWVSER
V*
Coding >Ophcf2|00729
ATGTCTACGGCATTGTCCATTGTTCGTCGAATGTCGACGCGCGCTCCCCTCGGTGCTCGCTGGCTCTCGACGCCC
TCGACGTCAGCAAACAGCCCGCCCAATCTGAAGCCTCTAACCGACGAACAGCGCCAATTCCTCTCCTCAGCCCTC
CGCGTCAATCAAGCCGGTGAGCTCGCCGCCACGCTCATATACACAGCGCAAACGCCGCCCATCATCCGCCGCCAC
CCGCACCTCCGACCCCTGATGAAGCACATGTACGACCAAGAAGCCGCCCATTTAACCACCTTCAACGCCCTCATT
CATAAACACCGCGTCCGGCCCACGGCCCTCGCGCCGTTGTGGACTGTACTCGCCACCGGTCTGGGTTGGTCGACG
GCCGTCATGGGCAGGGAGGCGGCCATGGCCTGCACTGAGGCCGTCGAGACGGAAATCGGAGGCCACTACAACAGT
CAGATTCGCACTCTGCTTGATATGATTTCTCAATGGGAACAGGAAGGCTACGACGTCGGGTCCGAGCTGTCGGAT
CTCGTCGCCATCCTCACCAGAATTCGCGACGAGGAGCTCGAGCACCTCGATCATGCCGTCGAGCACGACGCCAAG
AAGGCAGAGCCCTATTGGCTATTGACCGGAATCATACGCGCGGGCTGCCGTGGCGCCATCTGGGTTAGTGAGCGA
GTATGA
Transcript >Ophcf2|00729
ATGTCTACGGCATTGTCCATTGTTCGTCGAATGTCGACGCGCGCTCCCCTCGGTGCTCGCTGGCTCTCGACGCCC
TCGACGTCAGCAAACAGCCCGCCCAATCTGAAGCCTCTAACCGACGAACAGCGCCAATTCCTCTCCTCAGCCCTC
CGCGTCAATCAAGCCGGTGAGCTCGCCGCCACGCTCATATACACAGCGCAAACGCCGCCCATCATCCGCCGCCAC
CCGCACCTCCGACCCCTGATGAAGCACATGTACGACCAAGAAGCCGCCCATTTAACCACCTTCAACGCCCTCATT
CATAAACACCGCGTCCGGCCCACGGCCCTCGCGCCGTTGTGGACTGTACTCGCCACCGGTCTGGGTTGGTCGACG
GCCGTCATGGGCAGGGAGGCGGCCATGGCCTGCACTGAGGCCGTCGAGACGGAAATCGGAGGCCACTACAACAGT
CAGATTCGCACTCTGCTTGATATGATTTCTCAATGGGAACAGGAAGGCTACGACGTCGGGTCCGAGCTGTCGGAT
CTCGTCGCCATCCTCACCAGAATTCGCGACGAGGAGCTCGAGCACCTCGATCATGCCGTCGAGCACGACGCCAAG
AAGGCAGAGCCCTATTGGCTATTGACCGGAATCATACGCGCGGGCTGCCGTGGCGCCATCTGGGTTAGTGAGCGA
GTATGA
Gene >Ophcf2|00729
ATGTCTACGGCATTGTCCATTGTTCGTCGAATGTCGACGCGCGCTCCCCTCGGTGCTCGCTGGCTCTCGACGCCC
TCGACGTCAGCAAACAGCCCGCCCAATCTGAAGCCTCTAACCGACGAACAGCGCCAATTCCTCTCCTCAGCCGTC
AGTATCTCGCTCGTCCTCTCCTGCTCTGAAGGTCTCTAAACTCCTCTTCAGCTCCGCGTCAATCAAGCCGGTGAG
CTCGCCGCCACGCTCATATACACAGCGCAAACGCCGCCCATCATCCGCCGCCACCCGCACCTCCGACCCCTGATG
AAGCACATGTACGACCAAGAAGCCGCCCATTTAACCACCTTCAACGCCCTCATTCATAAACACCGCGTCCGGCCC
ACGGCCCTCGCGCCGTTGTGGACTGTACTCGCCACCGGTCTGGGTTGGTCGACGGCCGTCATGGGCAGGGAGGCG
GCCATGGCCTGCACTGAGGCCGTCGAGACGGAAATCGGAGGCCACTACAACAGTCAGATTCGCACTCTGCTTGAT
ATGATTTCTCAATGGGAACAGGAAGGCTACGACGTCGGGTCCGAGCTGTCGGATCTCGTCGCCATCCTCACCAGA
ATTCGCGACGAGGAGCTCGAGCACCTCGATCATGCCGTCGAGCACGACGCCAAGAAGGCAGAGCCCTATTGGCTA
TTGACCGGAATCATACGCGCGGGCTGCCGTGGCGCCATCTGGGTTAGTGAGCGAGTATGA

© 2023 - Robin Ohm - Utrecht University - The Netherlands

Built with Python Django and Wagtail