Fungal Genomics

at Utrecht University

General Properties

Protein IDOphcf2|00699
Gene name
Locationscaffold_01:2656691..2658479
Strand+
Gene length (bp)1788
Transcript length (bp)1788
Coding sequence length (bp)1788
Protein length (aa) 596

Overview

Your browser does not support drawing a protein figure.

PFAM Domains

PFAM Domain ID Short name Long name E-value Start End
PF02733 Dak1 Dak1 domain 8.8E-104 19 342
PF02734 Dak2 DAK2 domain 3.2E-39 416 588

GO

GO Term Description Terminal node
GO:0004371 glycerone kinase activity Yes
GO:0006071 glycerol metabolic process Yes
GO:0044262 cellular carbohydrate metabolic process No
GO:0044237 cellular metabolic process No
GO:0016772 transferase activity, transferring phosphorus-containing groups No
GO:0016773 phosphotransferase activity, alcohol group as acceptor No
GO:0009987 cellular process No
GO:0008152 metabolic process No
GO:0016740 transferase activity No
GO:0006066 alcohol metabolic process No
GO:0016301 kinase activity No
GO:0071704 organic substance metabolic process No
GO:0003824 catalytic activity No
GO:0044281 small molecule metabolic process No
GO:0044238 primary metabolic process No
GO:0003674 molecular_function No
GO:0019751 polyol metabolic process No
GO:0005975 carbohydrate metabolic process No
GO:1901615 organic hydroxy compound metabolic process No
GO:0019400 alditol metabolic process No
GO:0008150 biological_process No

Deeploc

[Help with interpreting the results of Deeploc 2.0]
Localizations Signals Cytoplasm Nucleus Extracellular Cell membrane Mitochondrion Plastid Endoplasmic reticulum Lysosome vacuole Golgi apparatus Peroxisome
Cytoplasm|Nucleus Peroxisomal targeting signal 0.6894 0.5303 0.0455 0.0222 0.5891 0.0666 0.0789 0.2011 0.1235 0.6238

SignalP

(None)

Transmembrane Domains

(None)

Transcription Factor Class

(None)

CAZymes

(None)

Secondary Metabolism

(None)

Expression data

Analysis 1: Expression analysis during behavioral modification. Published in: Will et al., G3, 2020

Click here for more information

Orthologs

Orthofinder run ID4
Orthogroup693
Change Orthofinder run
Species Protein ID
Ophiocordyceps australis 1348a (Ghana) OphauG2|5917
Ophiocordyceps australis map64 (Brazil) OphauB2|7259
Ophiocordyceps camponoti-floridani Ophcf2|00699 (this protein)
Ophiocordyceps camponoti-rufipedis Ophun1|4889
Ophiocordyceps kimflemingae Ophio5|6369
Ophiocordyceps subramaniannii Hirsu2|1197
Ophiocordyceps subramaniannii Hirsu2|2959

Sequences

Type of sequenceSequence
Locus Download genbank file of locus Download genbank file of locus (reverse complement)
The gene with 5 kb flanks (if sufficient flanking sequence is available). For use in cloning design programs. NOTE: features (genes or exons) that are only partially contained within the sequence are completely excluded.
Protein >Ophcf2|00699
MSKRHLFNSADGLVHRALRGLVACKPSLNLDTTNRVVLDSSHHESRVSLISGGGSGHEPAWAGFVGSNMLAAAVQ
GDIFASPSTRQIVAAVEAVPSREGTILVITNYTGDCLHFGLANEKVKAQGRRCRLLVCGDDVSVGRTAGRVGRRG
LAGQISVIKVMGAAAGAGASLDDVYDLGSALSAQIVSMAATLDHCHVPGRTEHGALADDEVEIGTGPHNEPGYEK
LSPVPEPADLVRRLLRHCLDETDADRAYVSFAAGDETVLLVNNFGGMSQLELLALVHETLEQLDREWKMKPVRVY
AGPLETSLNAPAFSLSVINLTAAAGGCRYSVDDIKAFLDVRTDTCWEAVAAGEQAIDRPRREHEELPKPASLPDG
PSVDADRDLRLDPSVLERMLRSACAALVEAEPDLTRWDTVMGDGDCGQTLKTGSSAVLAALDRGLARSGSVGEVL
LELEDVAESKMGGTLGGILGILFVSLRSAVEARVVDRRAGETTLTVWAAALSTALTSLRRYTPAEVGHRTVMDTL
IPFSDSLPDGFGAAVSAALAGAEATRTMKPQLGRATYVRAEHGREMPPDPGAWAAMVVIRALHHGLGASE*
Coding >Ophcf2|00699
ATGTCGAAACGCCACCTCTTCAACTCAGCCGACGGCCTCGTTCACAGAGCCCTCCGTGGCCTCGTCGCGTGTAAG
CCGAGCCTCAATCTCGACACAACCAACCGCGTAGTCCTCGACAGCTCCCACCATGAGAGCCGCGTCAGCCTCATC
AGCGGAGGGGGTTCCGGTCACGAGCCGGCATGGGCAGGATTCGTTGGTTCCAACATGCTGGCGGCCGCTGTGCAG
GGAGACATCTTTGCCAGCCCGAGCACGAGGCAGATCGTGGCGGCCGTAGAGGCAGTACCGAGTCGAGAGGGAACC
ATCCTCGTCATAACCAACTACACGGGCGACTGTCTTCACTTTGGCCTGGCCAACGAAAAGGTCAAGGCCCAGGGA
CGAAGGTGTCGCCTCCTCGTCTGCGGCGATGACGTCTCCGTCGGTCGGACGGCCGGAAGGGTCGGACGCCGAGGG
CTGGCCGGTCAGATCTCCGTAATCAAGGTCATGGGCGCCGCAGCCGGAGCCGGAGCTTCCCTCGACGACGTCTAC
GACCTCGGCTCCGCTTTATCGGCCCAGATCGTCTCCATGGCCGCCACGCTGGACCACTGCCACGTCCCCGGCCGG
ACCGAACACGGAGCGCTGGCCGACGACGAGGTGGAGATCGGCACGGGCCCCCACAATGAGCCGGGCTACGAGAAG
CTATCCCCCGTTCCGGAGCCGGCAGACCTCGTCCGACGGCTCCTTCGGCACTGCCTGGACGAGACGGACGCCGAC
CGTGCCTACGTGAGCTTCGCTGCTGGCGACGAGACCGTCTTGCTCGTCAACAACTTCGGCGGCATGTCACAGCTC
GAGCTGTTGGCCCTCGTCCATGAGACTCTCGAGCAGCTGGACCGCGAGTGGAAGATGAAGCCCGTCCGCGTCTAC
GCCGGCCCGCTCGAGACATCCCTCAACGCCCCGGCCTTTTCCCTATCCGTCATCAACCTGACGGCCGCAGCCGGC
GGGTGCCGCTACTCCGTCGACGACATCAAGGCCTTTCTCGACGTCAGGACGGATACCTGCTGGGAGGCCGTCGCC
GCCGGCGAGCAGGCCATTGATCGTCCCCGTCGAGAACACGAAGAGCTCCCGAAGCCCGCCTCACTGCCCGACGGG
CCGTCCGTCGATGCCGACCGTGACCTCCGGCTCGATCCGTCGGTGCTGGAACGGATGCTCCGCTCCGCCTGTGCC
GCCCTCGTCGAGGCCGAGCCGGACCTGACCCGCTGGGACACCGTCATGGGCGACGGAGACTGCGGCCAGACGCTC
AAGACGGGATCCTCGGCCGTTCTGGCCGCCCTGGACAGGGGCTTGGCTCGCTCCGGCTCCGTCGGCGAGGTGCTT
CTCGAGCTGGAGGACGTGGCGGAGAGCAAGATGGGCGGCACCCTCGGCGGCATCCTCGGCATCCTCTTCGTCTCG
CTCCGGTCCGCCGTCGAAGCCCGAGTCGTCGACAGGAGAGCTGGAGAGACGACGCTGACCGTCTGGGCAGCGGCG
CTGTCGACGGCCCTGACCAGCCTGCGTCGCTACACGCCAGCCGAGGTCGGCCATCGGACCGTCATGGACACCCTC
ATCCCCTTTTCCGACTCCCTCCCCGACGGCTTCGGAGCCGCCGTCTCCGCTGCTCTCGCGGGAGCGGAGGCTACC
AGGACCATGAAGCCGCAGTTGGGGAGGGCCACGTACGTCCGGGCCGAGCATGGCCGCGAGATGCCCCCCGACCCG
GGTGCTTGGGCGGCCATGGTGGTGATCCGGGCGCTACACCATGGGCTTGGAGCGTCCGAGTAA
Transcript >Ophcf2|00699
ATGTCGAAACGCCACCTCTTCAACTCAGCCGACGGCCTCGTTCACAGAGCCCTCCGTGGCCTCGTCGCGTGTAAG
CCGAGCCTCAATCTCGACACAACCAACCGCGTAGTCCTCGACAGCTCCCACCATGAGAGCCGCGTCAGCCTCATC
AGCGGAGGGGGTTCCGGTCACGAGCCGGCATGGGCAGGATTCGTTGGTTCCAACATGCTGGCGGCCGCTGTGCAG
GGAGACATCTTTGCCAGCCCGAGCACGAGGCAGATCGTGGCGGCCGTAGAGGCAGTACCGAGTCGAGAGGGAACC
ATCCTCGTCATAACCAACTACACGGGCGACTGTCTTCACTTTGGCCTGGCCAACGAAAAGGTCAAGGCCCAGGGA
CGAAGGTGTCGCCTCCTCGTCTGCGGCGATGACGTCTCCGTCGGTCGGACGGCCGGAAGGGTCGGACGCCGAGGG
CTGGCCGGTCAGATCTCCGTAATCAAGGTCATGGGCGCCGCAGCCGGAGCCGGAGCTTCCCTCGACGACGTCTAC
GACCTCGGCTCCGCTTTATCGGCCCAGATCGTCTCCATGGCCGCCACGCTGGACCACTGCCACGTCCCCGGCCGG
ACCGAACACGGAGCGCTGGCCGACGACGAGGTGGAGATCGGCACGGGCCCCCACAATGAGCCGGGCTACGAGAAG
CTATCCCCCGTTCCGGAGCCGGCAGACCTCGTCCGACGGCTCCTTCGGCACTGCCTGGACGAGACGGACGCCGAC
CGTGCCTACGTGAGCTTCGCTGCTGGCGACGAGACCGTCTTGCTCGTCAACAACTTCGGCGGCATGTCACAGCTC
GAGCTGTTGGCCCTCGTCCATGAGACTCTCGAGCAGCTGGACCGCGAGTGGAAGATGAAGCCCGTCCGCGTCTAC
GCCGGCCCGCTCGAGACATCCCTCAACGCCCCGGCCTTTTCCCTATCCGTCATCAACCTGACGGCCGCAGCCGGC
GGGTGCCGCTACTCCGTCGACGACATCAAGGCCTTTCTCGACGTCAGGACGGATACCTGCTGGGAGGCCGTCGCC
GCCGGCGAGCAGGCCATTGATCGTCCCCGTCGAGAACACGAAGAGCTCCCGAAGCCCGCCTCACTGCCCGACGGG
CCGTCCGTCGATGCCGACCGTGACCTCCGGCTCGATCCGTCGGTGCTGGAACGGATGCTCCGCTCCGCCTGTGCC
GCCCTCGTCGAGGCCGAGCCGGACCTGACCCGCTGGGACACCGTCATGGGCGACGGAGACTGCGGCCAGACGCTC
AAGACGGGATCCTCGGCCGTTCTGGCCGCCCTGGACAGGGGCTTGGCTCGCTCCGGCTCCGTCGGCGAGGTGCTT
CTCGAGCTGGAGGACGTGGCGGAGAGCAAGATGGGCGGCACCCTCGGCGGCATCCTCGGCATCCTCTTCGTCTCG
CTCCGGTCCGCCGTCGAAGCCCGAGTCGTCGACAGGAGAGCTGGAGAGACGACGCTGACCGTCTGGGCAGCGGCG
CTGTCGACGGCCCTGACCAGCCTGCGTCGCTACACGCCAGCCGAGGTCGGCCATCGGACCGTCATGGACACCCTC
ATCCCCTTTTCCGACTCCCTCCCCGACGGCTTCGGAGCCGCCGTCTCCGCTGCTCTCGCGGGAGCGGAGGCTACC
AGGACCATGAAGCCGCAGTTGGGGAGGGCCACGTACGTCCGGGCCGAGCATGGCCGCGAGATGCCCCCCGACCCG
GGTGCTTGGGCGGCCATGGTGGTGATCCGGGCGCTACACCATGGGCTTGGAGCGTCCGAGTAA
Gene >Ophcf2|00699
ATGTCGAAACGCCACCTCTTCAACTCAGCCGACGGCCTCGTTCACAGAGCCCTCCGTGGCCTCGTCGCGTGTAAG
CCGAGCCTCAATCTCGACACAACCAACCGCGTAGTCCTCGACAGCTCCCACCATGAGAGCCGCGTCAGCCTCATC
AGCGGAGGGGGTTCCGGTCACGAGCCGGCATGGGCAGGATTCGTTGGTTCCAACATGCTGGCGGCCGCTGTGCAG
GGAGACATCTTTGCCAGCCCGAGCACGAGGCAGATCGTGGCGGCCGTAGAGGCAGTACCGAGTCGAGAGGGAACC
ATCCTCGTCATAACCAACTACACGGGCGACTGTCTTCACTTTGGCCTGGCCAACGAAAAGGTCAAGGCCCAGGGA
CGAAGGTGTCGCCTCCTCGTCTGCGGCGATGACGTCTCCGTCGGTCGGACGGCCGGAAGGGTCGGACGCCGAGGG
CTGGCCGGTCAGATCTCCGTAATCAAGGTCATGGGCGCCGCAGCCGGAGCCGGAGCTTCCCTCGACGACGTCTAC
GACCTCGGCTCCGCTTTATCGGCCCAGATCGTCTCCATGGCCGCCACGCTGGACCACTGCCACGTCCCCGGCCGG
ACCGAACACGGAGCGCTGGCCGACGACGAGGTGGAGATCGGCACGGGCCCCCACAATGAGCCGGGCTACGAGAAG
CTATCCCCCGTTCCGGAGCCGGCAGACCTCGTCCGACGGCTCCTTCGGCACTGCCTGGACGAGACGGACGCCGAC
CGTGCCTACGTGAGCTTCGCTGCTGGCGACGAGACCGTCTTGCTCGTCAACAACTTCGGCGGCATGTCACAGCTC
GAGCTGTTGGCCCTCGTCCATGAGACTCTCGAGCAGCTGGACCGCGAGTGGAAGATGAAGCCCGTCCGCGTCTAC
GCCGGCCCGCTCGAGACATCCCTCAACGCCCCGGCCTTTTCCCTATCCGTCATCAACCTGACGGCCGCAGCCGGC
GGGTGCCGCTACTCCGTCGACGACATCAAGGCCTTTCTCGACGTCAGGACGGATACCTGCTGGGAGGCCGTCGCC
GCCGGCGAGCAGGCCATTGATCGTCCCCGTCGAGAACACGAAGAGCTCCCGAAGCCCGCCTCACTGCCCGACGGG
CCGTCCGTCGATGCCGACCGTGACCTCCGGCTCGATCCGTCGGTGCTGGAACGGATGCTCCGCTCCGCCTGTGCC
GCCCTCGTCGAGGCCGAGCCGGACCTGACCCGCTGGGACACCGTCATGGGCGACGGAGACTGCGGCCAGACGCTC
AAGACGGGATCCTCGGCCGTTCTGGCCGCCCTGGACAGGGGCTTGGCTCGCTCCGGCTCCGTCGGCGAGGTGCTT
CTCGAGCTGGAGGACGTGGCGGAGAGCAAGATGGGCGGCACCCTCGGCGGCATCCTCGGCATCCTCTTCGTCTCG
CTCCGGTCCGCCGTCGAAGCCCGAGTCGTCGACAGGAGAGCTGGAGAGACGACGCTGACCGTCTGGGCAGCGGCG
CTGTCGACGGCCCTGACCAGCCTGCGTCGCTACACGCCAGCCGAGGTCGGCCATCGGACCGTCATGGACACCCTC
ATCCCCTTTTCCGACTCCCTCCCCGACGGCTTCGGAGCCGCCGTCTCCGCTGCTCTCGCGGGAGCGGAGGCTACC
AGGACCATGAAGCCGCAGTTGGGGAGGGCCACGTACGTCCGGGCCGAGCATGGCCGCGAGATGCCCCCCGACCCG
GGTGCTTGGGCGGCCATGGTGGTGATCCGGGCGCTACACCATGGGCTTGGAGCGTCCGAGTAA

© 2023 - Robin Ohm - Utrecht University - The Netherlands

Built with Python Django and Wagtail