Fungal Genomics

at Utrecht University

General Properties

Protein IDOphcf2|00697
Gene name
Locationscaffold_01:2650023..2653434
Strand+
Gene length (bp)3411
Transcript length (bp)3090
Coding sequence length (bp)3090
Protein length (aa) 1030

Overview

Your browser does not support drawing a protein figure.

PFAM Domains

PFAM Domain ID Short name Long name E-value Start End
PF06032 DUF917 Protein of unknown function (DUF917) 1.9E-113 640 1007
PF05378 Hydant_A_N Hydantoinase/oxoprolinase N-terminal region 5.8E-24 5 181
PF01968 Hydantoinase_A Hydantoinase/oxoprolinase 1.5E-16 205 496

GO

GO Term Description Terminal node
GO:0016787 hydrolase activity Yes
GO:0003674 molecular_function No
GO:0003824 catalytic activity No

Deeploc

[Help with interpreting the results of Deeploc 2.0]
Localizations Signals Cytoplasm Nucleus Extracellular Cell membrane Mitochondrion Plastid Endoplasmic reticulum Lysosome vacuole Golgi apparatus Peroxisome
Cytoplasm Nuclear export signal 0.6686 0.5016 0.0295 0.0717 0.0993 0.0839 0.1017 0.3013 0.2025 0.0326

SignalP

(None)

Transmembrane Domains

(None)

Transcription Factor Class

(None)

CAZymes

(None)

Secondary Metabolism

(None)

Expression data

Analysis 1: Expression analysis during behavioral modification. Published in: Will et al., G3, 2020

Click here for more information

Orthologs

Orthofinder run ID4
Orthogroup4438
Change Orthofinder run
Species Protein ID
Ophiocordyceps australis 1348a (Ghana) OphauG2|5913
Ophiocordyceps australis map64 (Brazil) OphauB2|2355
Ophiocordyceps camponoti-floridani Ophcf2|00697 (this protein)
Ophiocordyceps camponoti-rufipedis Ophun1|4891
Ophiocordyceps kimflemingae Ophio5|7070
Ophiocordyceps subramaniannii Hirsu2|9201

Sequences

Type of sequenceSequence
Locus Download genbank file of locus Download genbank file of locus (reverse complement)
The gene with 5 kb flanks (if sufficient flanking sequence is available). For use in cloning design programs. NOTE: features (genes or exons) that are only partially contained within the sequence are completely excluded.
Protein >Ophcf2|00697
MSLYRIGVDVGGTNTDAAILDLTALDQPGRGVLASHKTPTTADITGGIEASIRAVLRASAVDQDGVLSVTIGTTH
FINALVEADARRLDRVAVIRLCGPFTRQLPPLSGFPVGLRRVLDGGVHYLDGGLEMDGREISALDPEQIRRAARE
IVARGVGAVALVGVFSPLDHEGLHEERCREMLVGEAPRLRVVCSRSMGSTGLLERENATILNAAILRTARRVERG
FRRAMRRLRLRCPLFLSQNDGTLIDARLAAEMPVKTFASGPTNSMTGAAFLAGIDLAASVDADRGGGGDGDGAPQ
VLVVDIGGTTTDVCALLPSGFPRQAPGFVELGGVRTAFSMPEVLSVGLGGGSRVVVHEGAGPDPHAGSVSVGPAS
VGHRLREQARVFGGSTLTATDVIVAAGGADHLGDARLVRHLLPGATVDLACRDIRRKLEALIDRMRVSAAPVHVL
LVGGGAILVKDGELAGVDKCIRPVHQGAANAVGAAIANVSGEVDRLEVLGSREESHLLDSACRRAIDLAVEKGAS
RHQVRVVDITKTPLQYMSRETIRIQVRAVGRLAIPSGPAPSWSGAESPVSESDEHGLDDDDDDDDDDDDDNHDDD
MQKAMIPDALTPTTKPTLGIDLATYRPRVRAGVWYVSEIDLELMATGCGVLGTGGGGPTYYEYLKSLHCRRGPDG
GKMRVVSARSLADDDVVCFGSWYGSPSVINERIPAGGEIAAAVDAVNGIKGVGSFAALCLVEIGGGNGLCAFSNG
IHYDCPVIDGDAMGRAYPTLFHTTFSVYGYEPTPCSVTDALGNIVVAMRTETPYHLEKLIRSASVEMGLSCASSP
NPLPASAVKTHSVPNTLSQAWYLGRAVHMARRSKTSYVDAIFGVCTGKLLFTGKITDVHRYIGGGYTMGAVLLAP
LSDEERESPAIASRQPVPTDKHIIIPFQNEYLYAAHCDSVGSEPSREVVCTVPSLISILGQDGEAIGSQDLRYGL
RVNVIALPAHPLWRTSRALKVGGPEGFGLKMAEVAVDTGEKFTAARSVIDEFGE*
Coding >Ophcf2|00697
ATGTCCCTCTACCGCATCGGCGTCGACGTCGGCGGCACAAACACCGATGCCGCCATCCTCGACCTCACCGCCCTC
GACCAGCCCGGCCGCGGCGTCCTGGCCTCTCACAAGACGCCCACCACAGCGGACATCACAGGCGGTATCGAGGCC
TCCATCCGTGCCGTTCTCCGGGCCTCGGCCGTGGACCAAGATGGCGTCCTGAGCGTCACCATCGGCACCACGCAC
TTCATCAACGCCCTCGTCGAGGCCGATGCCCGCCGCCTCGACCGCGTGGCCGTCATCCGTCTCTGCGGACCTTTT
ACGCGTCAGCTACCGCCCCTCTCGGGCTTCCCCGTCGGTCTCCGCCGCGTCCTCGACGGAGGCGTTCACTACCTC
GACGGAGGACTGGAGATGGACGGCCGCGAGATATCGGCCCTGGATCCGGAGCAGATTCGACGCGCGGCTCGCGAG
ATAGTAGCTCGGGGAGTCGGAGCCGTTGCCCTCGTCGGCGTCTTCTCGCCCCTGGACCACGAGGGCCTTCACGAA
GAGCGCTGTCGCGAGATGCTCGTCGGCGAGGCCCCTCGTCTGCGCGTCGTCTGCTCGCGTTCCATGGGCTCGACC
GGTCTTCTCGAGCGGGAGAACGCGACGATTCTTAACGCTGCCATTCTGCGGACGGCCAGGCGTGTAGAGAGGGGC
TTCCGGAGGGCCATGCGTCGTCTCCGCCTCCGCTGTCCGCTCTTCCTGTCGCAGAACGACGGCACGCTCATCGAC
GCCCGCCTTGCCGCCGAGATGCCCGTCAAGACATTCGCCAGCGGACCGACCAACAGCATGACGGGCGCTGCTTTC
CTGGCGGGGATCGACCTGGCCGCCTCTGTAGATGCCGATCGGGGCGGCGGAGGCGATGGCGACGGAGCGCCCCAG
GTGTTGGTCGTCGACATCGGCGGGACGACGACCGACGTCTGCGCCCTGCTACCCTCGGGCTTCCCTCGCCAAGCT
CCGGGCTTCGTCGAGCTCGGCGGCGTACGCACCGCCTTCTCCATGCCCGAGGTGCTCTCCGTCGGTCTCGGCGGC
GGAAGCCGGGTGGTGGTTCACGAGGGGGCCGGGCCGGACCCGCATGCCGGCTCCGTGTCGGTCGGCCCGGCGTCG
GTCGGACACCGGCTCCGCGAACAGGCGCGTGTCTTTGGCGGATCGACGCTGACGGCCACGGATGTCATCGTTGCT
GCTGGGGGCGCTGATCATCTCGGTGATGCGCGTCTTGTTCGCCATCTGCTGCCCGGGGCGACGGTCGATCTCGCC
TGTCGCGATATCCGGCGCAAGCTGGAGGCCCTCATCGACCGCATGAGGGTTTCTGCCGCGCCGGTACACGTCCTG
CTCGTCGGTGGAGGCGCCATCCTCGTCAAGGACGGAGAGCTGGCGGGTGTCGATAAGTGTATCCGTCCCGTGCAT
CAGGGGGCGGCCAACGCGGTCGGGGCGGCCATCGCCAACGTCTCGGGAGAGGTCGACCGTCTCGAGGTGCTGGGC
AGTCGAGAAGAGAGCCATCTTCTCGACTCTGCTTGTCGGCGTGCCATCGATCTGGCGGTGGAAAAGGGCGCCAGT
CGTCATCAAGTGCGTGTTGTTGACATCACCAAGACGCCGCTTCAATACATGTCGCGGGAGACTATCCGGATCCAG
GTCCGTGCTGTGGGCCGGTTGGCTATCCCGTCCGGCCCGGCTCCGAGCTGGTCCGGCGCCGAGTCTCCGGTGAGC
GAATCCGATGAGCATGGTCTGGACGATGATGACGACGATGATGACGACGACGACGACGACAACCACGACGACGAC
ATGCAAAAGGCCATGATCCCAGACGCCCTCACCCCGACGACAAAGCCGACCCTCGGCATCGACCTCGCCACCTAC
CGCCCCCGAGTCCGTGCCGGCGTCTGGTACGTGTCCGAGATAGATCTCGAGCTCATGGCCACCGGCTGCGGCGTC
CTCGGCACCGGAGGAGGCGGCCCGACCTACTACGAGTATCTCAAGAGTCTACACTGCCGACGCGGACCGGACGGC
GGGAAGATGAGAGTCGTCTCGGCCCGTTCGCTGGCTGATGACGACGTCGTATGCTTCGGGTCGTGGTACGGCAGC
CCGAGCGTCATCAACGAACGGATCCCGGCTGGGGGTGAGATTGCGGCGGCTGTCGATGCTGTGAATGGCATCAAG
GGCGTTGGCTCCTTTGCTGCGCTGTGTCTTGTTGAGATCGGTGGAGGCAATGGCCTCTGTGCTTTTTCCAACGGC
ATTCACTACGACTGCCCCGTCATCGATGGCGATGCCATGGGCAGGGCCTATCCGACCTTGTTTCACACCACTTTT
AGCGTCTACGGCTACGAACCGACGCCATGCTCCGTGACGGATGCCCTCGGCAACATCGTCGTCGCCATGAGAACA
GAGACGCCTTACCACCTCGAGAAGCTCATCCGGTCAGCATCCGTCGAGATGGGCCTGTCATGCGCGTCGAGTCCG
AATCCGCTACCGGCATCGGCCGTCAAGACGCACAGCGTGCCGAATACCTTATCGCAGGCCTGGTATCTGGGCCGA
GCCGTACACATGGCCAGACGCAGCAAGACGAGCTACGTGGATGCCATTTTCGGCGTCTGCACTGGAAAGCTCCTC
TTCACCGGCAAAATCACAGACGTCCACCGCTACATCGGCGGCGGCTACACCATGGGCGCCGTTCTGCTCGCCCCC
CTGAGCGACGAGGAGCGCGAGTCGCCCGCCATCGCCAGCCGCCAGCCGGTCCCTACAGACAAGCACATCATCATC
CCGTTCCAGAACGAGTATCTTTACGCTGCCCACTGCGATTCGGTCGGTTCCGAGCCATCACGCGAGGTCGTCTGC
ACCGTCCCGAGCCTCATCTCCATCCTGGGCCAAGACGGCGAGGCCATCGGATCTCAGGACCTGCGCTATGGCCTC
CGCGTCAACGTCATTGCTCTGCCTGCCCATCCGCTGTGGCGGACGAGTCGGGCTCTCAAGGTGGGCGGTCCGGAA
GGCTTCGGCTTGAAGATGGCCGAGGTGGCCGTCGATACGGGCGAGAAGTTTACGGCGGCGCGGAGCGTGATAGAC
GAGTTTGGGGAGTAG
Transcript >Ophcf2|00697
ATGTCCCTCTACCGCATCGGCGTCGACGTCGGCGGCACAAACACCGATGCCGCCATCCTCGACCTCACCGCCCTC
GACCAGCCCGGCCGCGGCGTCCTGGCCTCTCACAAGACGCCCACCACAGCGGACATCACAGGCGGTATCGAGGCC
TCCATCCGTGCCGTTCTCCGGGCCTCGGCCGTGGACCAAGATGGCGTCCTGAGCGTCACCATCGGCACCACGCAC
TTCATCAACGCCCTCGTCGAGGCCGATGCCCGCCGCCTCGACCGCGTGGCCGTCATCCGTCTCTGCGGACCTTTT
ACGCGTCAGCTACCGCCCCTCTCGGGCTTCCCCGTCGGTCTCCGCCGCGTCCTCGACGGAGGCGTTCACTACCTC
GACGGAGGACTGGAGATGGACGGCCGCGAGATATCGGCCCTGGATCCGGAGCAGATTCGACGCGCGGCTCGCGAG
ATAGTAGCTCGGGGAGTCGGAGCCGTTGCCCTCGTCGGCGTCTTCTCGCCCCTGGACCACGAGGGCCTTCACGAA
GAGCGCTGTCGCGAGATGCTCGTCGGCGAGGCCCCTCGTCTGCGCGTCGTCTGCTCGCGTTCCATGGGCTCGACC
GGTCTTCTCGAGCGGGAGAACGCGACGATTCTTAACGCTGCCATTCTGCGGACGGCCAGGCGTGTAGAGAGGGGC
TTCCGGAGGGCCATGCGTCGTCTCCGCCTCCGCTGTCCGCTCTTCCTGTCGCAGAACGACGGCACGCTCATCGAC
GCCCGCCTTGCCGCCGAGATGCCCGTCAAGACATTCGCCAGCGGACCGACCAACAGCATGACGGGCGCTGCTTTC
CTGGCGGGGATCGACCTGGCCGCCTCTGTAGATGCCGATCGGGGCGGCGGAGGCGATGGCGACGGAGCGCCCCAG
GTGTTGGTCGTCGACATCGGCGGGACGACGACCGACGTCTGCGCCCTGCTACCCTCGGGCTTCCCTCGCCAAGCT
CCGGGCTTCGTCGAGCTCGGCGGCGTACGCACCGCCTTCTCCATGCCCGAGGTGCTCTCCGTCGGTCTCGGCGGC
GGAAGCCGGGTGGTGGTTCACGAGGGGGCCGGGCCGGACCCGCATGCCGGCTCCGTGTCGGTCGGCCCGGCGTCG
GTCGGACACCGGCTCCGCGAACAGGCGCGTGTCTTTGGCGGATCGACGCTGACGGCCACGGATGTCATCGTTGCT
GCTGGGGGCGCTGATCATCTCGGTGATGCGCGTCTTGTTCGCCATCTGCTGCCCGGGGCGACGGTCGATCTCGCC
TGTCGCGATATCCGGCGCAAGCTGGAGGCCCTCATCGACCGCATGAGGGTTTCTGCCGCGCCGGTACACGTCCTG
CTCGTCGGTGGAGGCGCCATCCTCGTCAAGGACGGAGAGCTGGCGGGTGTCGATAAGTGTATCCGTCCCGTGCAT
CAGGGGGCGGCCAACGCGGTCGGGGCGGCCATCGCCAACGTCTCGGGAGAGGTCGACCGTCTCGAGGTGCTGGGC
AGTCGAGAAGAGAGCCATCTTCTCGACTCTGCTTGTCGGCGTGCCATCGATCTGGCGGTGGAAAAGGGCGCCAGT
CGTCATCAAGTGCGTGTTGTTGACATCACCAAGACGCCGCTTCAATACATGTCGCGGGAGACTATCCGGATCCAG
GTCCGTGCTGTGGGCCGGTTGGCTATCCCGTCCGGCCCGGCTCCGAGCTGGTCCGGCGCCGAGTCTCCGGTGAGC
GAATCCGATGAGCATGGTCTGGACGATGATGACGACGATGATGACGACGACGACGACGACAACCACGACGACGAC
ATGCAAAAGGCCATGATCCCAGACGCCCTCACCCCGACGACAAAGCCGACCCTCGGCATCGACCTCGCCACCTAC
CGCCCCCGAGTCCGTGCCGGCGTCTGGTACGTGTCCGAGATAGATCTCGAGCTCATGGCCACCGGCTGCGGCGTC
CTCGGCACCGGAGGAGGCGGCCCGACCTACTACGAGTATCTCAAGAGTCTACACTGCCGACGCGGACCGGACGGC
GGGAAGATGAGAGTCGTCTCGGCCCGTTCGCTGGCTGATGACGACGTCGTATGCTTCGGGTCGTGGTACGGCAGC
CCGAGCGTCATCAACGAACGGATCCCGGCTGGGGGTGAGATTGCGGCGGCTGTCGATGCTGTGAATGGCATCAAG
GGCGTTGGCTCCTTTGCTGCGCTGTGTCTTGTTGAGATCGGTGGAGGCAATGGCCTCTGTGCTTTTTCCAACGGC
ATTCACTACGACTGCCCCGTCATCGATGGCGATGCCATGGGCAGGGCCTATCCGACCTTGTTTCACACCACTTTT
AGCGTCTACGGCTACGAACCGACGCCATGCTCCGTGACGGATGCCCTCGGCAACATCGTCGTCGCCATGAGAACA
GAGACGCCTTACCACCTCGAGAAGCTCATCCGGTCAGCATCCGTCGAGATGGGCCTGTCATGCGCGTCGAGTCCG
AATCCGCTACCGGCATCGGCCGTCAAGACGCACAGCGTGCCGAATACCTTATCGCAGGCCTGGTATCTGGGCCGA
GCCGTACACATGGCCAGACGCAGCAAGACGAGCTACGTGGATGCCATTTTCGGCGTCTGCACTGGAAAGCTCCTC
TTCACCGGCAAAATCACAGACGTCCACCGCTACATCGGCGGCGGCTACACCATGGGCGCCGTTCTGCTCGCCCCC
CTGAGCGACGAGGAGCGCGAGTCGCCCGCCATCGCCAGCCGCCAGCCGGTCCCTACAGACAAGCACATCATCATC
CCGTTCCAGAACGAGTATCTTTACGCTGCCCACTGCGATTCGGTCGGTTCCGAGCCATCACGCGAGGTCGTCTGC
ACCGTCCCGAGCCTCATCTCCATCCTGGGCCAAGACGGCGAGGCCATCGGATCTCAGGACCTGCGCTATGGCCTC
CGCGTCAACGTCATTGCTCTGCCTGCCCATCCGCTGTGGCGGACGAGTCGGGCTCTCAAGGTGGGCGGTCCGGAA
GGCTTCGGCTTGAAGATGGCCGAGGTGGCCGTCGATACGGGCGAGAAGTTTACGGCGGCGCGGAGCGTGATAGAC
GAGTTTGGGGAGTAG
Gene >Ophcf2|00697
ATGTCCCTCTACCGCATCGGCGTCGACGTCGGCGGCACAAACACCGATGCCGCCATCCTCGACCTCACCGCCCTC
GACCAGCCCGGCCGCGGCGTCCTGGCCTCTCACAAGACGCCCACCACAGCGGACATCACAGGCGGTATCGAGGCC
TCCATCCGTGCCGTTCTCCGGGCCTCGGCCGTGGACCAAGATGGCGTCCTGAGCGTCACCATCGGCACCACGCAC
TTCATCAACGCCCTCGTCGAGGCCGATGCCCGCCGCCTCGACCGCGTGGCCGTCATCCGTCTCTGCGGACCTTTT
ACGCGTCAGCTACCGCCCCTCTCGGGCTTCCCCGTCGGTCTCCGCCGCGTCCTCGACGGAGGCGTTCACTACCTC
GACGGAGGACTGGAGATGGACGGCCGCGAGATATCGGCCCTGGATCCGGAGCAGATTCGACGCGCGGCTCGCGAG
ATAGTAGCTCGGGGAGTCGGAGCCGTTGCCCTCGTCGGCGTCTTCTCGCCCCTGGACCACGAGGGCCTTCACGAA
GAGCGCTGTCGCGAGATGCTCGTCGGCGAGGCCCCTCGTCTGCGCGTCGTCTGCTCGCGTTCCATGGGCTCGACC
GGTCTTCTCGAGCGGGAGAACGCGACGATTCTTAACGCTGCCATTCTGCGGACGGCCAGGCGTGTAGAGAGGGGC
TTCCGGAGGGCCATGCGTCGTCTCCGCCTCCGCTGTCCGCTCTTCCTGTCGCAGAACGACGGCACGCTCATCGAC
GCCCGCCTTGCCGCCGAGATGCCCGTCAAGACATTCGCCAGCGGACCGACCAACAGCATGACGGGCGCTGCTTTC
CTGGCGGGGATCGACCTGGCCGCCTCTGTAGATGCCGATCGGGGCGGCGGAGGCGATGGCGACGGAGCGCCCCAG
GTGTTGGTCGTCGACATCGGCGGGACGACGACCGACGTCTGCGCCCTGCTACCCTCGGGCTTCCCTCGCCAAGCT
CCGGGCTTCGTCGAGCTCGGCGGCGTACGCACCGCCTTCTCCATGCCCGAGGTGCTCTCCGTCGGTCTCGGCGGC
GGAAGCCGGGTGGTGGTTCACGAGGGGGCCGGGCCGGACCCGCATGCCGGCTCCGTGTCGGTCGGCCCGGCGTCG
GTCGGACACCGGCTCCGCGAACAGGCGCGTGTCTTTGGCGGATCGACGCTGACGGCCACGGATGTCATCGTTGCT
GCTGGGGGCGCTGATCATCTCGGTGATGCGCGTCTTGTTCGCCATCTGCTGCCCGGGGCGACGGTCGATCTCGCC
TGTCGCGATATCCGGCGCAAGCTGGAGGCCCTCATCGACCGCATGAGGGTTTCTGCCGCGCCGGTACACGTCCTG
CTCGTCGGTGGAGGCGCCATCCTCGTCAAGGACGGAGAGCTGGCGGGTGTCGATAAGTGTATCCGTCCCGTGCAT
CAGGGGGCGGCCAACGCGGTCGGGGCGGCCATCGCCAACGTCTCGGGAGAGGTCGACCGTCTCGAGGTGCTGGGC
AGTCGAGAAGAGAGCCATCTTCTCGACTCTGCTTGTCGGCGTGCCATCGATCTGGCGGTGGAAAAGGGCGCCAGT
CGTCATCAAGTGCGTGTTGTTGACATCACCAAGACGCCGCTTCAATACATGTCGCGGGAGACTATCCGGATCCAG
GTCCGTGCTGTGGGCCGGTTGGCTATCCCGTCCGGCCCGGCTCCGAGCTGGTCCGGCGCCGAGTCTCCGGTGAGC
GAATCCGATGAGCATGGTCTGGACGATGATGACGACGATGATGACGACGACGACGACGACAACCACGACGACGAC
ATGCAAAAGGCCATGATCCCAGACGCCCTCACCCCGACGACAAAGCCGACCCTCGGCATCGACCTCGCCACCTAC
CGCCCCCGAGTCCGTGCCGGCGTCTGGTACGTGTCCGAGATAGATCTCGAGCTCATGGCCACCGGCTGCGGCGTC
CTCGGCACCGGAGGAGGCGGCCCGACCTACTACGAGTATCTCAAGAGTCTACACTGCCGACGCGGACCGGACGGC
GGGAAGATGAGAGTCGTCTCGGCCCGTTCGCTGGCTGATGACGACGTCGTATGCTTCGGGTCGTGGTACGGCAGC
CCGAGCGTCATCAACGAACGGATCCCGGCTGGGGGTGAGATTGCGGCGGCTGTCGATGCTGTGAATGGCATCAAG
GGCGTTGGCTCCTTTGCTGCGCTGTGTCTTGTTGAGATGTGAGCTGCTCCCTTGCTCCCTTTCTACCTTGCCGTT
TCTTGCCCCTGACTGACTACATCATGCTTCAGCGGTGGAGGCAATGGCCTCTGTGCTTTTTCCAACGGCATTCAC
TACGACTGCCCCGTCATCGATGGCGATGCCATGGGCAGGGCCTATCCGACCTTGTTTCACAGTGAGTTGCTGATC
TGTATTTTCATTATTGAGCTGCCCTTCTGATGTCGAGAAGCCACTTTTAGCGTCTACGGCTACGAACCGACGCCA
TGCTCCGTGACGGATGCCCTCGGCAACATCGTCGTCGCCATGGTATCTTCTTCTCTCTTCCCCCCCCCCCCCCCT
CTGTGCCCCGGTAGCAGTCGGCTGAGACAATTGGTAGAGAACAGAGACGCCTTACCACCTCGAGAAGCTCATCCG
GTCAGCATCCGTCGAGATGGGCCTGTCATGCGCGTCGAGTCCGAATCCGCTACCGGCATCGGCCGTCAAGACGCA
CAGCGTGCCGAATACCTTATCGCAGGCCTGGTATCTGGGCCGAGCCGTACACATGGCCAGACGCAGCAAGACGAG
CTACGTGGATGCCATTGTAAGCATTTCTTCCGTCGTCTCATTCTCTTTCCCATCTTCCCTTTATAACTCCTTTCA
CCCTACATACCCCTGAATAGCCCCTTTTTTTTACTCTCCACCCCTCCACCTCAACTCACACCCGTACAGTTCGGC
GTCTGCACTGGAAAGCTCCTCTTCACCGGCAAAATCACAGACGTCCACCGCTACATCGGCGGCGGCTACACCATG
GGCGCCGTTCTGCTCGCCCCCCTGAGCGACGAGGAGCGCGAGTCGCCCGCCATCGCCAGCCGCCAGCCGGTCCCT
ACAGACAAGCACATCATCATCCCGTTCCAGAACGAGTATCTTTACGCTGCCCACTGCGATTCGGTCGGTTCCGAG
CCATCACGCGAGGTCGTCTGCACCGTCCCGAGCCTCATCTCCATCCTGGGCCAAGACGGCGAGGCCATCGGATCT
CAGGACCTGCGCTATGGCCTCCGCGTCAACGTCATTGCTCTGCCTGCCCATCCGCTGTGGCGGACGAGTCGGGCT
CTCAAGGTGGGCGGTCCGGAAGGCTTCGGCTTGAAGATGGCCGAGGTGGCCGTCGATACGGGCGAGAAGTTTACG
GCGGCGCGGAGCGTGATAGACGAGTTTGGGGAGTAG

© 2023 - Robin Ohm - Utrecht University - The Netherlands

Built with Python Django and Wagtail