Fungal Genomics

at Utrecht University

General Properties

Protein IDOphcf2|00692
Gene name
Locationscaffold_01:2635787..2637775
Strand+
Gene length (bp)1988
Transcript length (bp)1926
Coding sequence length (bp)1926
Protein length (aa) 642

Your browser does not support drawing a protein figure.

PFAM Domains

PFAM Domain ID Short name Long name E-value Start End
PF01061 ABC2_membrane ABC-2 type transporter 2.9E-23 366 574
PF00005 ABC_tran ABC transporter 5.6E-22 56 225
PF19055 ABC2_membrane_7 ABC-2 type transporter 1.1E-06 255 318

GO

GO Term Description Terminal node
GO:0005524 ATP binding Yes
GO:0140359 ABC-type transporter activity Yes
GO:0016020 membrane Yes
GO:0003674 molecular_function No
GO:0097159 organic cyclic compound binding No
GO:0110165 cellular anatomical entity No
GO:1901363 heterocyclic compound binding No
GO:0043168 anion binding No
GO:0022857 transmembrane transporter activity No
GO:0032559 adenyl ribonucleotide binding No
GO:0005488 binding No
GO:0022804 active transmembrane transporter activity No
GO:0005215 transporter activity No
GO:1901265 nucleoside phosphate binding No
GO:0005575 cellular_component No
GO:0140657 ATP-dependent activity No
GO:0032553 ribonucleotide binding No
GO:0017076 purine nucleotide binding No
GO:0042626 ATPase-coupled transmembrane transporter activity No
GO:0032555 purine ribonucleotide binding No
GO:0000166 nucleotide binding No
GO:0036094 small molecule binding No
GO:0015399 primary active transmembrane transporter activity No
GO:0043167 ion binding No
GO:0030554 adenyl nucleotide binding No
GO:0097367 carbohydrate derivative binding No
GO:0035639 purine ribonucleoside triphosphate binding No

SignalP

[Help with interpreting these statistics]
SignalP signal predicted Location
(based on Ymax)
D score
(significance: > 0.45)
No 1 - 55 0.45

Transmembrane Domains

Domain # Start End Length
1 382 401 19
2 416 438 22
3 459 481 22
4 496 518 22
5 525 543 18
6 619 638 19

Transcription Factor Class

(None)

Expression data

Analysis 1: Expression analysis during behavioral modification. Published in: Will et al., G3, 2020

Expression values

Label Description Expression (RPKM) Confidence interval (low) Confidence interval (high)
Fungus Fungus in pure culture 0.00 0.00 0.00
Alive In ants, during behavior modification 1.15 0.08 2.23
Dead In ants, recently dead 0.96 0.09 1.82

Differential expression

Label1 Label2 Q-value Significant difference
Alive Fungus 0.000238 yes
Alive Dead 0.634371 no
Dead Fungus 0.000238 yes

Sequences

Type of sequenceSequence
Locus Download genbank file of locus
The gene with 5 kb flanks (if sufficient flanking sequence is available). For use in cloning design programs. NOTE: features (genes or exons) that are only partially contained within the sequence are completely excluded.
Protein >Ophcf2|00692
MTSLTPSAVDVERQTSDEKNLTNSTVQSIAWRGVTITVPGRKGAPAKKIIDGAQGVVEAGELCAIMGPSGAGKTS
LLNHLARRESQAAKMEGEVLVNGRVVADEEFRRLTSFVEQQDALISSLTCFETVDFNVRLTGTKCVFFSCLVSLQ
YPLTGERGKRGRRTKTERIAFVNKLLRSLGLDGMENSFVGPFYRGNISGGEKRRLSVASQVGGEPKILFLDEPTS
GIDSTGSQQMVRYLRELAKSTGIIIVCSIHQPSAAIFHKFDKLVLVSEGRMCYFGSTTDVVPYLEKRGHQMPPLS
NPAEFILDLVNTSFSTDQSALDNLCRSWESSDLADELRRVIEDTHSHDDSADDPSLSRPSLAGRVVTLLRRSLIK
SYRDPTVYLLRAVLYLLVAIIIGTIWPRHDGSQQSIDNLMTATFISTGFASLISVSCVPPVIEDIKHHLQEKRNG
YSGCLEFSLSNFLLGLPYLLLISLLFSVVTLPLNGLKMSAGPFFCWLLWHFLGLVTMESAILLIAALVIKLNTAV
ALLLLVSTIQFAAGGYVVKAKIMTMFYKYVLYYWDFLTYTYRGMLSGQFRDATYDCGPGCQCTYPPMPEDPCRIS
GNRVLEQLEYSPKNLGRDIGIVLAMVVGYRLAAWVVISRRG*
Coding >Ophcf2|00692
ATGACCTCTCTCACCCCATCCGCCGTCGACGTCGAGCGGCAGACATCAGATGAAAAGAACTTGACCAACTCGACG
GTGCAGAGCATCGCCTGGCGCGGCGTCACCATAACCGTGCCTGGCCGCAAGGGGGCTCCGGCGAAGAAGATTATC
GATGGCGCCCAGGGCGTTGTCGAGGCGGGCGAGCTGTGTGCCATCATGGGTCCTTCAGGTGCCGGAAAGACCTCT
CTCCTTAACCACCTCGCCAGACGCGAGAGCCAGGCCGCCAAGATGGAGGGCGAGGTGCTCGTCAACGGCAGGGTC
GTTGCGGATGAAGAGTTCCGTCGGCTCACTTCGTTCGTGGAGCAGCAGGATGCTCTCATCTCGTCGCTCACTTGC
TTCGAGACGGTTGATTTCAACGTCAGGCTGACTGGCACCAAGTGCGTCTTTTTCTCGTGTCTTGTTTCGCTCCAA
TATCCGCTGACGGGTGAACGGGGAAAACGCGGCAGACGGACCAAGACGGAACGTATCGCCTTTGTCAACAAGCTC
CTCCGATCCCTGGGCCTCGACGGGATGGAAAACTCCTTCGTCGGCCCCTTTTACCGCGGCAACATCTCCGGCGGT
GAGAAGCGGCGGCTCTCCGTCGCCAGCCAGGTAGGAGGCGAGCCCAAGATCCTCTTCCTCGACGAGCCCACCAGC
GGCATCGACTCGACCGGCAGCCAGCAGATGGTTCGGTATCTGAGGGAGCTGGCCAAGAGCACGGGCATCATCATC
GTCTGCTCCATTCATCAGCCGTCGGCCGCCATCTTCCACAAGTTCGACAAGTTGGTGCTGGTTTCCGAGGGGAGG
ATGTGCTATTTCGGTTCGACGACGGATGTTGTGCCTTACTTGGAGAAAAGGGGTCATCAGATGCCCCCCCTGTCC
AACCCTGCCGAGTTCATCCTCGATCTCGTCAACACCAGCTTCTCGACGGATCAATCAGCACTCGACAACCTTTGC
CGATCTTGGGAGAGCTCGGATCTTGCAGACGAGCTTCGCAGGGTCATCGAGGACACGCACAGTCACGACGATTCA
GCCGACGATCCGTCCTTGTCTCGCCCGAGCTTGGCTGGTCGGGTCGTAACCTTGCTTCGCCGCAGCTTGATCAAG
AGCTATCGAGACCCGACCGTCTACCTCCTTCGGGCCGTGCTGTACCTGTTGGTCGCCATCATCATCGGCACGATT
TGGCCGCGTCACGATGGGAGTCAACAGTCCATCGACAATCTGATGACGGCCACTTTTATTTCCACGGGCTTTGCG
TCTCTCATCTCGGTATCCTGCGTTCCGCCGGTCATCGAAGACATCAAACACCATCTGCAGGAGAAACGCAATGGC
TACAGCGGCTGTCTGGAATTCTCCCTCTCCAACTTCCTCCTTGGCCTGCCTTATCTGCTACTCATCTCCCTCCTC
TTCTCCGTCGTCACTCTCCCGCTGAACGGGCTCAAAATGTCGGCTGGGCCGTTCTTTTGTTGGCTTCTTTGGCAT
TTTCTGGGTCTGGTGACCATGGAGTCCGCCATCCTCTTGATCGCGGCGCTCGTCATCAAGCTCAACACGGCGGTG
GCCTTGCTGCTGCTCGTCAGCACCATCCAGTTCGCCGCCGGTGGCTACGTGGTCAAGGCCAAGATCATGACCATG
TTTTACAAGTACGTCTTGTACTACTGGGACTTCTTGACCTATACATACAGGGGTATGCTGTCTGGCCAGTTCCGC
GACGCCACGTACGACTGCGGACCGGGCTGCCAGTGCACCTATCCGCCCATGCCCGAGGACCCTTGCCGCATTTCC
GGCAATCGAGTCCTCGAGCAACTCGAATATTCGCCAAAGAATCTCGGCAGGGATATTGGGATAGTATTGGCCATG
GTGGTCGGCTACCGGCTGGCAGCGTGGGTTGTCATCAGTCGTCGAGGCTGA
Transcript >Ophcf2|00692
ATGACCTCTCTCACCCCATCCGCCGTCGACGTCGAGCGGCAGACATCAGATGAAAAGAACTTGACCAACTCGACG
GTGCAGAGCATCGCCTGGCGCGGCGTCACCATAACCGTGCCTGGCCGCAAGGGGGCTCCGGCGAAGAAGATTATC
GATGGCGCCCAGGGCGTTGTCGAGGCGGGCGAGCTGTGTGCCATCATGGGTCCTTCAGGTGCCGGAAAGACCTCT
CTCCTTAACCACCTCGCCAGACGCGAGAGCCAGGCCGCCAAGATGGAGGGCGAGGTGCTCGTCAACGGCAGGGTC
GTTGCGGATGAAGAGTTCCGTCGGCTCACTTCGTTCGTGGAGCAGCAGGATGCTCTCATCTCGTCGCTCACTTGC
TTCGAGACGGTTGATTTCAACGTCAGGCTGACTGGCACCAAGTGCGTCTTTTTCTCGTGTCTTGTTTCGCTCCAA
TATCCGCTGACGGGTGAACGGGGAAAACGCGGCAGACGGACCAAGACGGAACGTATCGCCTTTGTCAACAAGCTC
CTCCGATCCCTGGGCCTCGACGGGATGGAAAACTCCTTCGTCGGCCCCTTTTACCGCGGCAACATCTCCGGCGGT
GAGAAGCGGCGGCTCTCCGTCGCCAGCCAGGTAGGAGGCGAGCCCAAGATCCTCTTCCTCGACGAGCCCACCAGC
GGCATCGACTCGACCGGCAGCCAGCAGATGGTTCGGTATCTGAGGGAGCTGGCCAAGAGCACGGGCATCATCATC
GTCTGCTCCATTCATCAGCCGTCGGCCGCCATCTTCCACAAGTTCGACAAGTTGGTGCTGGTTTCCGAGGGGAGG
ATGTGCTATTTCGGTTCGACGACGGATGTTGTGCCTTACTTGGAGAAAAGGGGTCATCAGATGCCCCCCCTGTCC
AACCCTGCCGAGTTCATCCTCGATCTCGTCAACACCAGCTTCTCGACGGATCAATCAGCACTCGACAACCTTTGC
CGATCTTGGGAGAGCTCGGATCTTGCAGACGAGCTTCGCAGGGTCATCGAGGACACGCACAGTCACGACGATTCA
GCCGACGATCCGTCCTTGTCTCGCCCGAGCTTGGCTGGTCGGGTCGTAACCTTGCTTCGCCGCAGCTTGATCAAG
AGCTATCGAGACCCGACCGTCTACCTCCTTCGGGCCGTGCTGTACCTGTTGGTCGCCATCATCATCGGCACGATT
TGGCCGCGTCACGATGGGAGTCAACAGTCCATCGACAATCTGATGACGGCCACTTTTATTTCCACGGGCTTTGCG
TCTCTCATCTCGGTATCCTGCGTTCCGCCGGTCATCGAAGACATCAAACACCATCTGCAGGAGAAACGCAATGGC
TACAGCGGCTGTCTGGAATTCTCCCTCTCCAACTTCCTCCTTGGCCTGCCTTATCTGCTACTCATCTCCCTCCTC
TTCTCCGTCGTCACTCTCCCGCTGAACGGGCTCAAAATGTCGGCTGGGCCGTTCTTTTGTTGGCTTCTTTGGCAT
TTTCTGGGTCTGGTGACCATGGAGTCCGCCATCCTCTTGATCGCGGCGCTCGTCATCAAGCTCAACACGGCGGTG
GCCTTGCTGCTGCTCGTCAGCACCATCCAGTTCGCCGCCGGTGGCTACGTGGTCAAGGCCAAGATCATGACCATG
TTTTACAAGTACGTCTTGTACTACTGGGACTTCTTGACCTATACATACAGGGGTATGCTGTCTGGCCAGTTCCGC
GACGCCACGTACGACTGCGGACCGGGCTGCCAGTGCACCTATCCGCCCATGCCCGAGGACCCTTGCCGCATTTCC
GGCAATCGAGTCCTCGAGCAACTCGAATATTCGCCAAAGAATCTCGGCAGGGATATTGGGATAGTATTGGCCATG
GTGGTCGGCTACCGGCTGGCAGCGTGGGTTGTCATCAGTCGTCGAGGCTGA
Gene >Ophcf2|00692
ATGACCTCTCTCACCCCATCCGCCGTCGACGTCGAGCGGCAGACATCAGATGAAAAGAACTTGACCAACTCGACG
GTGCAGAGCATCGCCTGGCGCGGCGTCACCATAACCGTGCCTGGCCGCAAGGGGGCTCCGGCGAAGAAGATTATC
GATGGCGCCCAGGGCGTTGTCGAGGCGGGTAACGAGATCCCAGCCATTGCTTTCCCCATCGGGATGGATAGGCTG
AGAGTCCCCTTTTAGGCGAGCTGTGTGCCATCATGGGTCCTTCAGGTGCCGGAAAGACCTCTCTCCTTAACCACC
TCGCCAGACGCGAGAGCCAGGCCGCCAAGATGGAGGGCGAGGTGCTCGTCAACGGCAGGGTCGTTGCGGATGAAG
AGTTCCGTCGGCTCACTTCGTTCGTGGAGCAGCAGGATGCTCTCATCTCGTCGCTCACTTGCTTCGAGACGGTTG
ATTTCAACGTCAGGCTGACTGGCACCAAGTGCGTCTTTTTCTCGTGTCTTGTTTCGCTCCAATATCCGCTGACGG
GTGAACGGGGAAAACGCGGCAGACGGACCAAGACGGAACGTATCGCCTTTGTCAACAAGCTCCTCCGATCCCTGG
GCCTCGACGGGATGGAAAACTCCTTCGTCGGCCCCTTTTACCGCGGCAACATCTCCGGCGGTGAGAAGCGGCGGC
TCTCCGTCGCCAGCCAGGTAGGAGGCGAGCCCAAGATCCTCTTCCTCGACGAGCCCACCAGCGGCATCGACTCGA
CCGGCAGCCAGCAGATGGTTCGGTATCTGAGGGAGCTGGCCAAGAGCACGGGCATCATCATCGTCTGCTCCATTC
ATCAGCCGTCGGCCGCCATCTTCCACAAGTTCGACAAGTTGGTGCTGGTTTCCGAGGGGAGGATGTGCTATTTCG
GTTCGACGACGGATGTTGTGCCTTACTTGGAGAAAAGGGGTCATCAGATGCCCCCCCTGTCCAACCCTGCCGAGT
TCATCCTCGATCTCGTCAACACCAGCTTCTCGACGGATCAATCAGCACTCGACAACCTTTGCCGATCTTGGGAGA
GCTCGGATCTTGCAGACGAGCTTCGCAGGGTCATCGAGGACACGCACAGTCACGACGATTCAGCCGACGATCCGT
CCTTGTCTCGCCCGAGCTTGGCTGGTCGGGTCGTAACCTTGCTTCGCCGCAGCTTGATCAAGAGCTATCGAGACC
CGACCGTCTACCTCCTTCGGGCCGTGCTGTACCTGTTGGTCGCCATCATCATCGGCACGATTTGGCCGCGTCACG
ATGGGAGTCAACAGTCCATCGACAATCTGATGACGGCCACTTTTATTTCCACGGGCTTTGCGTCTCTCATCTCGG
TATCCTGCGTTCCGCCGGTCATCGAAGACATCAAACACCATCTGCAGGAGAAACGCAATGGCTACAGCGGCTGTC
TGGAATTCTCCCTCTCCAACTTCCTCCTTGGCCTGCCTTATCTGCTACTCATCTCCCTCCTCTTCTCCGTCGTCA
CTCTCCCGCTGAACGGGCTCAAAATGTCGGCTGGGCCGTTCTTTTGTTGGCTTCTTTGGCATTTTCTGGGTCTGG
TGACCATGGAGTCCGCCATCCTCTTGATCGCGGCGCTCGTCATCAAGCTCAACACGGCGGTGGCCTTGCTGCTGC
TCGTCAGCACCATCCAGTTCGCCGCCGGTGGCTACGTGGTCAAGGCCAAGATCATGACCATGTTTTACAAGTACG
TCTTGTACTACTGGGACTTCTTGACCTATACATACAGGGGTATGCTGTCTGGCCAGTTCCGCGACGCCACGTACG
ACTGCGGACCGGGCTGCCAGTGCACCTATCCGCCCATGCCCGAGGACCCTTGCCGCATTTCCGGCAATCGAGTCC
TCGAGCAACTCGAATATTCGCCAAAGAATCTCGGCAGGGATATTGGGATAGTATTGGCCATGGTGGTCGGCTACC
GGCTGGCAGCGTGGGTTGTCATCAGTCGTCGAGGCTGA

© 2022 - Robin Ohm - Utrecht University - The Netherlands

Built with Python Django and Wagtail