Fungal Genomics

at Utrecht University

General Properties

Protein IDOphcf2|00687
Gene name
Locationscaffold_01:2620562..2624636
Strand+
Gene length (bp)4074
Transcript length (bp)3963
Coding sequence length (bp)3963
Protein length (aa) 1321

Your browser does not support drawing a protein figure.

PFAM Domains

PFAM Domain ID Short name Long name E-value Start End
PF00702 Hydrolase haloacid dehalogenase-like hydrolase 2.9E-10 492 751
PF00122 E1-E2_ATPase E1-E2 ATPase 6.8E-16 257 475

GO

(None)

SignalP

[Help with interpreting these statistics]
SignalP signal predicted Location
(based on Ymax)
D score
(significance: > 0.45)
No 1 - 44 0.5

Transmembrane Domains

Domain # Start End Length
1 21 43 22
2 58 80 22
3 201 218 17
4 222 241 19
5 407 429 22
6 1074 1096 22
7 1109 1131 22

Transcription Factor Class

(None)

Expression data

Analysis 1: Expression analysis during behavioral modification. Published in: Will et al., G3, 2020

Click here for more information

Sequences

Type of sequenceSequence
Locus Download genbank file of locus
The gene with 5 kb flanks (if sufficient flanking sequence is available). For use in cloning design programs. NOTE: features (genes or exons) that are only partially contained within the sequence are completely excluded.
Protein >Ophcf2|00687
MPPLVDSAQIQRAELLRPLPFHFHAYVWPFVVIWPVFLRFYLTQNLYETYIGAPEWTFVWCATIITLQALVWLST
HWSVGLDARFRATKAASVHDAQLIKVVPVANAGSGEICRLLRDKNDGKDGLSFLFQKRRFLYNAQHNCFRTLQYD
IDAEPKPSIGHFQAWRGLEKQGEVSRIEQHYGKNTFDIPVPTFTELFKEHAVAPFFVFQVFCVGLWLLDEYWYYS
LFTLFMLVAFESTVVWQRQRTLNEFRGMSIKPYDIWVFRLGKWTEVQTDSLLPGDLVSVGRTKEDSGIACDMLLV
EGTAIVNEAMLSGESTPLLKDSIQLRPADARLDPEGLDKNAFLWGGTKVLQVTHGNPEQEKPALASRVAPPPDNG
AMAVVIKTGFETSQGSLVRTMIYSTERVSANNFEALLFILFLLIFALAASWYVWDEGVRKDRKRSKLLLDCVLIV
TSVVPPELPMELSLAVNTSLAALSKLAIFCTEPFRIPYGGRIDVACFDKTGTLTGEDLVVEGIAGLGLASQAAAD
KKEEDGAHSDMTTVSNAGLETQLVLATAHALVKLDEGEIVGDPMEKATLSSLGWSLGRNDVLSSTNKTSTTQGTV
QIKRRFQFSSALKRQSSVAMVHGVDSNTGKKIRGTFIGVKGAPETIMKMLVNVPADYEETYKYFTRKGSRVLALA
YKQLSVDSELGASKINDLKREKVECDLMFAGFLVLHCPLKDDAKEAVQMLNESSHRVVMITGDNPLTAVHVAREV
EIVDREVLILDAPENNAGGQKLVWKSVDDKTSITVDPSKAIDADILRMNDLCVTGYALAKFKDQPGWNSLLRHTW
VYARVSPKQKEEILLGLKDMGYYTLMAGDGTNDVGALKQAHIGIALLNGTKEDLTRIAEHARNTRMKDMYQKQCD
LMKRFNQPTPPVPVMIAHLYPPGPTNPNYNKAIEREAKNKNMTIEAYAKAQGHPTETIVTPGAQSLVNAADGRTA
RQAEASKKAAGFADKLASGMLEAELGDDEPPTLKLGDASVAAPFTSKLRDVIAVPNIIRQGRCTLVATIQMYKIL
ALNCLISAYSLSVLYLEGIKFGDTQYTISGMLMSVCFLSISRARVVEGLSKERPQPNIFNVYIIGSILGQFAVHI
VTLIYVARLCDRIEPRSTDNLNLEAEFEPSLLNSAIYLLQLIQQVSTFAINYQGRPFRESLSENRVMFYGIVGVS
SLAFVCALELVPEINEAMKLVRFTEEFKVKMAGSMVVDYLACFVIEKMLKATFSDYRPRDIADRRPEQLERETVR
KKVLERKKADEEERKRMEKVAEFERQVEERKRKLREWRNGQQRTG*
Coding >Ophcf2|00687
ATGCCGCCCCTTGTCGATAGCGCTCAGATTCAGCGAGCCGAACTCCTGCGGCCGCTTCCCTTCCACTTCCACGCC
TACGTCTGGCCCTTCGTCGTCATCTGGCCCGTCTTCTTGCGCTTCTACCTCACGCAGAACCTCTATGAAACATAC
ATCGGTGCCCCTGAGTGGACCTTTGTCTGGTGCGCCACCATCATCACCCTCCAGGCTCTCGTCTGGTTGAGCACC
CACTGGAGTGTCGGACTCGACGCACGCTTCAGAGCCACCAAGGCCGCCAGTGTTCACGACGCCCAACTCATCAAG
GTCGTTCCGGTTGCGAATGCTGGCTCGGGCGAGATCTGCCGCCTGCTTCGCGACAAGAACGACGGCAAAGATGGC
CTCTCCTTTCTCTTCCAGAAGCGCAGATTTCTGTACAACGCCCAGCACAACTGCTTCCGGACGCTTCAGTACGAC
ATCGATGCTGAACCGAAGCCCTCCATCGGTCACTTCCAGGCGTGGCGCGGCCTCGAAAAGCAGGGCGAAGTCTCG
CGCATCGAGCAGCATTACGGAAAGAACACCTTTGACATCCCCGTGCCTACTTTCACCGAGCTCTTCAAGGAGCAT
GCCGTGGCGCCATTCTTCGTCTTCCAGGTCTTCTGCGTCGGCCTCTGGCTCCTCGACGAGTACTGGTATTATTCG
CTCTTCACCCTCTTCATGCTCGTCGCCTTCGAGAGCACTGTCGTCTGGCAACGTCAGCGCACGCTCAACGAGTTC
CGAGGCATGAGCATCAAGCCCTACGATATCTGGGTCTTCCGACTCGGCAAGTGGACCGAGGTCCAGACCGATTCT
CTGCTTCCCGGCGATCTCGTGTCGGTAGGCCGAACCAAGGAAGACAGCGGAATTGCCTGCGACATGCTCCTCGTC
GAGGGCACCGCCATTGTCAATGAGGCCATGCTCTCCGGAGAGAGCACGCCCCTGCTCAAGGACTCGATCCAGCTT
CGCCCCGCAGACGCCCGGCTCGACCCCGAGGGCCTCGACAAGAATGCCTTCCTCTGGGGAGGCACCAAGGTGCTC
CAGGTGACTCACGGCAACCCCGAGCAAGAGAAACCAGCCTTGGCTTCGCGCGTCGCTCCGCCTCCAGACAACGGC
GCCATGGCAGTCGTCATCAAGACCGGGTTCGAAACCTCTCAAGGCAGCCTTGTACGAACCATGATCTACTCCACG
GAGCGCGTCTCGGCCAACAACTTTGAGGCTCTCCTTTTCATCCTGTTCCTCCTCATCTTTGCGCTCGCGGCCTCG
TGGTACGTCTGGGACGAGGGCGTTCGGAAGGACCGCAAACGATCCAAGCTCTTGCTGGACTGCGTCCTCATCGTC
ACCAGCGTTGTCCCTCCCGAACTGCCCATGGAGCTCAGTCTGGCGGTCAATACCAGTCTGGCGGCCCTCTCCAAG
CTCGCCATCTTCTGTACAGAACCGTTCCGCATCCCCTACGGTGGCCGCATCGACGTCGCTTGTTTCGACAAGACC
GGGACTCTGACCGGCGAGGACCTGGTTGTCGAGGGCATCGCGGGGCTGGGTCTCGCCAGTCAAGCCGCAGCTGAC
AAGAAGGAGGAGGACGGTGCCCATTCTGACATGACTACCGTCTCCAACGCCGGCCTCGAAACCCAACTCGTGCTC
GCCACGGCACACGCGCTGGTCAAGCTCGACGAGGGCGAAATCGTCGGCGATCCGATGGAAAAGGCCACCCTCTCG
TCTCTCGGATGGTCCCTCGGCCGCAATGACGTGCTTTCGAGCACCAACAAGACCAGCACCACGCAGGGCACCGTC
CAGATTAAGCGTCGCTTCCAGTTCTCGTCTGCCCTCAAGCGGCAGAGCTCCGTCGCCATGGTCCACGGTGTCGAC
TCCAACACGGGTAAGAAAATCAGGGGTACTTTTATCGGTGTTAAGGGCGCGCCCGAGACCATCATGAAGATGCTG
GTCAACGTGCCCGCCGACTACGAAGAGACGTACAAGTACTTTACCCGCAAGGGCTCGCGCGTCCTGGCCCTGGCC
TACAAGCAGCTTTCGGTGGACTCGGAGCTCGGCGCCAGCAAGATCAACGACCTGAAGCGGGAAAAGGTGGAATGC
GACCTGATGTTTGCCGGCTTCCTCGTCCTTCACTGCCCCCTCAAAGACGACGCCAAGGAGGCCGTCCAGATGCTC
AACGAGAGCAGCCATCGCGTCGTCATGATCACCGGGGACAATCCCCTGACGGCCGTCCACGTCGCTCGCGAGGTC
GAGATTGTCGACCGTGAAGTCCTCATTCTCGATGCGCCGGAGAATAACGCAGGCGGCCAGAAGCTCGTATGGAAG
AGCGTCGACGACAAGACCAGCATCACGGTCGACCCGTCCAAAGCCATCGATGCCGACATCTTGAGGATGAACGAC
CTGTGCGTGACGGGGTATGCGCTGGCCAAGTTCAAGGACCAGCCAGGCTGGAACTCTCTCTTGCGCCACACCTGG
GTCTACGCCCGCGTCTCGCCCAAGCAAAAGGAAGAGATCCTGCTGGGTCTCAAGGATATGGGCTACTATACGCTC
ATGGCGGGCGACGGCACCAACGATGTCGGGGCCCTGAAGCAGGCACACATCGGCATCGCCCTGCTCAACGGCACC
AAGGAAGACTTGACGCGCATCGCCGAACACGCTCGAAACACCAGGATGAAGGACATGTATCAGAAGCAGTGCGAC
CTCATGAAGCGCTTCAACCAGCCGACGCCGCCTGTACCTGTCATGATTGCCCACCTTTACCCCCCGGGTCCCACC
AACCCCAACTACAATAAGGCCATTGAGCGTGAAGCCAAGAACAAGAACATGACGATTGAGGCCTACGCGAAGGCG
CAGGGCCACCCAACGGAGACCATCGTGACGCCAGGCGCCCAGTCGCTCGTCAACGCCGCTGATGGACGCACTGCC
CGACAGGCCGAGGCGTCCAAGAAGGCGGCAGGCTTTGCCGATAAGCTGGCCTCGGGCATGCTCGAAGCCGAGCTC
GGGGACGACGAGCCGCCGACGCTGAAGCTGGGCGACGCCTCGGTGGCCGCACCCTTTACGTCCAAGCTCCGAGAC
GTCATTGCCGTCCCCAACATCATCCGTCAGGGGCGCTGCACCCTGGTGGCGACGATTCAGATGTACAAGATCCTG
GCTCTCAACTGCCTCATCAGCGCCTACTCCCTGTCCGTCCTCTACCTCGAGGGCATCAAGTTTGGAGACACGCAG
TACACCATCAGCGGTATGCTCATGTCTGTTTGCTTCCTCAGCATCAGCCGGGCGCGGGTCGTCGAGGGCCTGAGC
AAGGAACGTCCCCAGCCCAACATCTTCAACGTGTACATCATCGGCTCTATCCTCGGCCAGTTCGCCGTCCACATC
GTCACCCTCATCTATGTTGCTCGGCTCTGCGACAGGATCGAACCGCGCTCGACTGATAATCTCAACCTGGAAGCC
GAGTTTGAGCCCTCCCTCCTCAACTCGGCCATCTATCTGCTGCAACTGATCCAGCAGGTTTCGACCTTCGCCATC
AACTACCAGGGCCGTCCCTTTCGCGAATCTCTGTCGGAGAATAGGGTCATGTTTTACGGCATCGTCGGCGTGTCG
AGTCTCGCCTTTGTGTGTGCGCTGGAGCTGGTGCCGGAGATTAACGAGGCGATGAAGCTCGTGCGTTTCACCGAG
GAGTTCAAGGTGAAGATGGCGGGCAGCATGGTTGTCGACTACCTGGCCTGCTTCGTCATCGAAAAGATGTTGAAG
GCAACCTTTAGCGACTACCGCCCACGCGACATTGCGGACCGACGGCCCGAGCAGCTCGAGCGCGAGACGGTACGC
AAGAAGGTGCTGGAGCGCAAGAAGGCCGACGAGGAGGAGAGGAAGCGGATGGAGAAGGTGGCCGAGTTCGAGCGA
CAGGTCGAGGAACGCAAGCGGAAGCTGCGCGAGTGGCGGAACGGCCAGCAGCGGACGGGTTAA
Transcript >Ophcf2|00687
ATGCCGCCCCTTGTCGATAGCGCTCAGATTCAGCGAGCCGAACTCCTGCGGCCGCTTCCCTTCCACTTCCACGCC
TACGTCTGGCCCTTCGTCGTCATCTGGCCCGTCTTCTTGCGCTTCTACCTCACGCAGAACCTCTATGAAACATAC
ATCGGTGCCCCTGAGTGGACCTTTGTCTGGTGCGCCACCATCATCACCCTCCAGGCTCTCGTCTGGTTGAGCACC
CACTGGAGTGTCGGACTCGACGCACGCTTCAGAGCCACCAAGGCCGCCAGTGTTCACGACGCCCAACTCATCAAG
GTCGTTCCGGTTGCGAATGCTGGCTCGGGCGAGATCTGCCGCCTGCTTCGCGACAAGAACGACGGCAAAGATGGC
CTCTCCTTTCTCTTCCAGAAGCGCAGATTTCTGTACAACGCCCAGCACAACTGCTTCCGGACGCTTCAGTACGAC
ATCGATGCTGAACCGAAGCCCTCCATCGGTCACTTCCAGGCGTGGCGCGGCCTCGAAAAGCAGGGCGAAGTCTCG
CGCATCGAGCAGCATTACGGAAAGAACACCTTTGACATCCCCGTGCCTACTTTCACCGAGCTCTTCAAGGAGCAT
GCCGTGGCGCCATTCTTCGTCTTCCAGGTCTTCTGCGTCGGCCTCTGGCTCCTCGACGAGTACTGGTATTATTCG
CTCTTCACCCTCTTCATGCTCGTCGCCTTCGAGAGCACTGTCGTCTGGCAACGTCAGCGCACGCTCAACGAGTTC
CGAGGCATGAGCATCAAGCCCTACGATATCTGGGTCTTCCGACTCGGCAAGTGGACCGAGGTCCAGACCGATTCT
CTGCTTCCCGGCGATCTCGTGTCGGTAGGCCGAACCAAGGAAGACAGCGGAATTGCCTGCGACATGCTCCTCGTC
GAGGGCACCGCCATTGTCAATGAGGCCATGCTCTCCGGAGAGAGCACGCCCCTGCTCAAGGACTCGATCCAGCTT
CGCCCCGCAGACGCCCGGCTCGACCCCGAGGGCCTCGACAAGAATGCCTTCCTCTGGGGAGGCACCAAGGTGCTC
CAGGTGACTCACGGCAACCCCGAGCAAGAGAAACCAGCCTTGGCTTCGCGCGTCGCTCCGCCTCCAGACAACGGC
GCCATGGCAGTCGTCATCAAGACCGGGTTCGAAACCTCTCAAGGCAGCCTTGTACGAACCATGATCTACTCCACG
GAGCGCGTCTCGGCCAACAACTTTGAGGCTCTCCTTTTCATCCTGTTCCTCCTCATCTTTGCGCTCGCGGCCTCG
TGGTACGTCTGGGACGAGGGCGTTCGGAAGGACCGCAAACGATCCAAGCTCTTGCTGGACTGCGTCCTCATCGTC
ACCAGCGTTGTCCCTCCCGAACTGCCCATGGAGCTCAGTCTGGCGGTCAATACCAGTCTGGCGGCCCTCTCCAAG
CTCGCCATCTTCTGTACAGAACCGTTCCGCATCCCCTACGGTGGCCGCATCGACGTCGCTTGTTTCGACAAGACC
GGGACTCTGACCGGCGAGGACCTGGTTGTCGAGGGCATCGCGGGGCTGGGTCTCGCCAGTCAAGCCGCAGCTGAC
AAGAAGGAGGAGGACGGTGCCCATTCTGACATGACTACCGTCTCCAACGCCGGCCTCGAAACCCAACTCGTGCTC
GCCACGGCACACGCGCTGGTCAAGCTCGACGAGGGCGAAATCGTCGGCGATCCGATGGAAAAGGCCACCCTCTCG
TCTCTCGGATGGTCCCTCGGCCGCAATGACGTGCTTTCGAGCACCAACAAGACCAGCACCACGCAGGGCACCGTC
CAGATTAAGCGTCGCTTCCAGTTCTCGTCTGCCCTCAAGCGGCAGAGCTCCGTCGCCATGGTCCACGGTGTCGAC
TCCAACACGGGTAAGAAAATCAGGGGTACTTTTATCGGTGTTAAGGGCGCGCCCGAGACCATCATGAAGATGCTG
GTCAACGTGCCCGCCGACTACGAAGAGACGTACAAGTACTTTACCCGCAAGGGCTCGCGCGTCCTGGCCCTGGCC
TACAAGCAGCTTTCGGTGGACTCGGAGCTCGGCGCCAGCAAGATCAACGACCTGAAGCGGGAAAAGGTGGAATGC
GACCTGATGTTTGCCGGCTTCCTCGTCCTTCACTGCCCCCTCAAAGACGACGCCAAGGAGGCCGTCCAGATGCTC
AACGAGAGCAGCCATCGCGTCGTCATGATCACCGGGGACAATCCCCTGACGGCCGTCCACGTCGCTCGCGAGGTC
GAGATTGTCGACCGTGAAGTCCTCATTCTCGATGCGCCGGAGAATAACGCAGGCGGCCAGAAGCTCGTATGGAAG
AGCGTCGACGACAAGACCAGCATCACGGTCGACCCGTCCAAAGCCATCGATGCCGACATCTTGAGGATGAACGAC
CTGTGCGTGACGGGGTATGCGCTGGCCAAGTTCAAGGACCAGCCAGGCTGGAACTCTCTCTTGCGCCACACCTGG
GTCTACGCCCGCGTCTCGCCCAAGCAAAAGGAAGAGATCCTGCTGGGTCTCAAGGATATGGGCTACTATACGCTC
ATGGCGGGCGACGGCACCAACGATGTCGGGGCCCTGAAGCAGGCACACATCGGCATCGCCCTGCTCAACGGCACC
AAGGAAGACTTGACGCGCATCGCCGAACACGCTCGAAACACCAGGATGAAGGACATGTATCAGAAGCAGTGCGAC
CTCATGAAGCGCTTCAACCAGCCGACGCCGCCTGTACCTGTCATGATTGCCCACCTTTACCCCCCGGGTCCCACC
AACCCCAACTACAATAAGGCCATTGAGCGTGAAGCCAAGAACAAGAACATGACGATTGAGGCCTACGCGAAGGCG
CAGGGCCACCCAACGGAGACCATCGTGACGCCAGGCGCCCAGTCGCTCGTCAACGCCGCTGATGGACGCACTGCC
CGACAGGCCGAGGCGTCCAAGAAGGCGGCAGGCTTTGCCGATAAGCTGGCCTCGGGCATGCTCGAAGCCGAGCTC
GGGGACGACGAGCCGCCGACGCTGAAGCTGGGCGACGCCTCGGTGGCCGCACCCTTTACGTCCAAGCTCCGAGAC
GTCATTGCCGTCCCCAACATCATCCGTCAGGGGCGCTGCACCCTGGTGGCGACGATTCAGATGTACAAGATCCTG
GCTCTCAACTGCCTCATCAGCGCCTACTCCCTGTCCGTCCTCTACCTCGAGGGCATCAAGTTTGGAGACACGCAG
TACACCATCAGCGGTATGCTCATGTCTGTTTGCTTCCTCAGCATCAGCCGGGCGCGGGTCGTCGAGGGCCTGAGC
AAGGAACGTCCCCAGCCCAACATCTTCAACGTGTACATCATCGGCTCTATCCTCGGCCAGTTCGCCGTCCACATC
GTCACCCTCATCTATGTTGCTCGGCTCTGCGACAGGATCGAACCGCGCTCGACTGATAATCTCAACCTGGAAGCC
GAGTTTGAGCCCTCCCTCCTCAACTCGGCCATCTATCTGCTGCAACTGATCCAGCAGGTTTCGACCTTCGCCATC
AACTACCAGGGCCGTCCCTTTCGCGAATCTCTGTCGGAGAATAGGGTCATGTTTTACGGCATCGTCGGCGTGTCG
AGTCTCGCCTTTGTGTGTGCGCTGGAGCTGGTGCCGGAGATTAACGAGGCGATGAAGCTCGTGCGTTTCACCGAG
GAGTTCAAGGTGAAGATGGCGGGCAGCATGGTTGTCGACTACCTGGCCTGCTTCGTCATCGAAAAGATGTTGAAG
GCAACCTTTAGCGACTACCGCCCACGCGACATTGCGGACCGACGGCCCGAGCAGCTCGAGCGCGAGACGGTACGC
AAGAAGGTGCTGGAGCGCAAGAAGGCCGACGAGGAGGAGAGGAAGCGGATGGAGAAGGTGGCCGAGTTCGAGCGA
CAGGTCGAGGAACGCAAGCGGAAGCTGCGCGAGTGGCGGAACGGCCAGCAGCGGACGGGTTAA
Gene >Ophcf2|00687
ATGCCGCCCCTTGTCGATAGCGCTCAGATTCAGCGAGCCGAACTCCTGCGGCCGCTTCCCTTCCACTTCCACGCC
TACGTCTGGCCCTTCGTCGTCATCTGGCCCGTCTTCTTGCGCTTCTACCTCACGCAGAACCTCTATGAAACATAC
ATCGGTGCCCCTGAGTGGACCTTTGTCTGGTGCGCCACCATCATCACCCTCCAGGCTCTCGTCTGGTTGAGCACC
CACTGGAGTGTCGGACTCGACGCACGCTTCAGAGCCACCAAGGCCGCCAGTGTTCACGACGCCCAACTCATCAAG
GTCGTTCCGGTTGCGAATGCTGGCTCGGGCGAGATCTGCCGCCTGCTTCGCGACAAGGTCGGCTTTGCTTTTCTG
TCCGATACTACAAGATATTCGCTGACTTGAACGTTATTCAGAACGACGGCAAAGATGGCCTCTCCTTTCTCTTCC
AGAAGCGCAGATTTCTGTACAACGCCCAGCACAACTGCTTCCGGACGCTTCAGTACGACATCGATGCTGAACCGA
AGCCCTCCATCGGTCACTTCCAGGCGTGGCGCGGCCTCGAAAAGCAGGGCGAAGTCTCGCGCATCGAGCAGCATT
ACGGAAAGAACACCTTTGACATCCCCGTGCCTACTTTCACCGAGCTCTTCAAGGAGCATGCCGTGGCGCCATTCT
TCGTCTTCCAGGTCTTCTGCGTCGGCCTCTGGCTCCTCGACGAGTACTGGTATTATTCGCTCTTCACCCTCTTCA
TGCTCGTCGCCTTCGAGAGCACTGTCGTCTGGCAACGTCAGCGCACGCTCAACGAGTTCCGAGGCATGAGCATCA
AGCCCTACGATATCTGGGTCTTCCGACTCGGCAAGTGGACCGAGGTCCAGACCGATTCTCTGCTTCCCGGCGATC
TCGTGTCGGTAGGCCGAACCAAGGAAGACAGCGGAATTGCCTGCGACATGCTCCTCGTCGAGGGCACCGCCATTG
TCAATGAGGCCATGCTCTCCGGAGAGAGCACGCCCCTGCTCAAGGACTCGATCCAGCTTCGCCCCGCAGACGCCC
GGCTCGACCCCGAGGGCCTCGACAAGAATGCCTTCCTCTGGGGAGGCACCAAGGTGCTCCAGGTGACTCACGGCA
ACCCCGAGCAAGAGAAACCAGCCTTGGCTTCGCGCGTCGCTCCGCCTCCAGACAACGGCGCCATGGCAGTCGTCA
TCAAGACCGGGTTCGAAACCTCTCAAGGCAGCCTTGTACGAACCATGATCTACTCCACGGAGCGCGTCTCGGCCA
ACAACTTTGAGGCTCTCCTTTTCATCCTGTTCCTCCTCATCTTTGCGCTCGCGGCCTCGTGGTACGTCTGGGACG
AGGGCGTTCGGAAGGACCGCAAACGATCCAAGCTCTTGCTGGACTGCGTCCTCATCGTCACCAGCGTTGTCCCTC
CCGAACTGCCCATGGAGCTCAGTCTGGCGGTCAATACCAGTCTGGCGGCCCTCTCCAAGCTCGCCATCTTCTGTA
CAGAACCGTTCCGCATCCCCTACGGTGGCCGCATCGACGTCGCTTGTTTCGACAAGACCGGGACTCTGACCGGCG
AGGACCTGGTTGTCGAGGGCATCGCGGGGCTGGGTCTCGCCAGTCAAGCCGCAGCTGACAAGAAGGAGGAGGACG
GTGCCCATTCTGACATGACTACCGTCTCCAACGCCGGCCTCGAAACCCAACTCGTGCTCGCCACGGCACACGCGC
TGGTCAAGCTCGACGAGGGCGAAATCGTCGGCGATCCGATGGAAAAGGCCACCCTCTCGTCTCTCGGATGGTCCC
TCGGCCGCAATGACGTGCTTTCGAGCACCAACAAGACCAGCACCACGCAGGGCACCGTCCAGATTAAGCGTCGCT
TCCAGTTCTCGTCTGCCCTCAAGCGGCAGAGCTCCGTCGCCATGGTCCACGGTGTCGACTCCAACACGGGTAAGA
AAATCAGGGGTACTTTTATCGGTGTTAAGGGCGCGCCCGAGACCATCATGAAGATGCTGGTCAACGTGCCCGCCG
ACTACGAAGAGACGTACAAGTACTTTACCCGCAAGGGCTCGCGCGTCCTGGCCCTGGCCTACAAGCAGCTTTCGG
TGGACTCGGAGCTCGGCGCCAGCAAGATCAACGACCTGAAGCGGGAAAAGGTGGAATGCGACCTGATGTTTGCCG
GCTTCCTCGTCCTTCACTGCCCCCTCAAAGACGACGCCAAGGAGGCCGTCCAGATGCTCAACGAGAGCAGCCATC
GCGTCGTCATGATCACCGGGGACAATCCCCTGACGGCCGTCCACGTCGCTCGCGAGGTCGAGATTGTCGACCGTG
AAGTCCTCATTCTCGATGCGCCGGAGAATAACGCAGGCGGCCAGAAGCTCGTATGGAAGAGCGTCGACGACAAGA
CCAGCATCACGGTCGACCCGTCCAAAGCCATCGATGCCGACATCTTGAGGATGAACGACCTGTGCGTGACGGGGT
ATGCGCTGGCCAAGTTCAAGGACCAGCCAGGCTGGAACTCTCTCTTGCGCCACACCTGGGTCTACGCCCGCGTCT
CGCCCAAGCAAAAGGAAGAGATCCTGCTGGGTCTCAAGGATATGGGCTACTATACGCTCATGGCGGGCGACGGCA
CCAACGATGTCGGGGCCCTGAAGCAGGCACACATCGGCATCGCCCTGCTCAACGGCACCAAGGAAGACTTGACGC
GCATCGCCGAACACGCTCGAAACACCAGGATGAAGGACATGTATCAGAAGCAGTGCGACCTCATGAAGCGCTTCA
ACCAGCCGACGCCGCCTGTACCTGTCATGATTGCCCACCTTTACCCCCCGGGTCCCACCAACCCCAACTACAATA
AGGCCATTGAGCGTGAAGCCAAGAACAAGAACATGACGATTGAGGCCTACGCGAAGGCGCAGGGCCACCCAACGG
AGACCATCGTGACGCCAGGCGCCCAGTCGCTCGTCAACGCCGCTGATGGACGCACTGCCCGACAGGCCGAGGCGT
CCAAGAAGGCGGCAGGCTTTGCCGATAAGCTGGCCTCGGGCATGCTCGAAGCCGAGCTCGGGGACGACGAGCCGC
CGACGCTGAAGCTGGGCGACGCCTCGGTGGCCGCACCCTTTACGTCCAAGCTCCGAGACGTCATTGCCGTCCCCA
ACATCATCCGTCAGGGGCGCTGCACCCTGGTGGCGACGATTCAGATGTACAAGATCCTGGCTCTCAACTGCCTCA
TCAGCGCCTACTCCCTGTCCGTCCTCTACCTCGAGGGCATCAAGTTTGGAGACACGCAGTACACCATCAGCGGTA
TGCTCATGTCTGTTTGCTTCCTCAGCATCAGCCGGGCGCGGGTCGTCGAGGGCCTGAGCAAGGAACGTCCCCAGC
CCAACATCTTCAACGTGTACATCATCGGCTCTATCCTCGGCCAGTTCGCCGTCCACATCGTCACCCTCATCTATG
TTGCTCGGCTCTGCGACAGGATCGAACCGTGAGCCCCTCAGGTTGCAGAGCTCTCCGCAATCTCGACTGACTTGT
CACAGGCGCTCGACTGATAATCTCAACCTGGAAGCCGAGTTTGAGCCCTCCCTCCTCAACTCGGCCATCTATCTG
CTGCAACTGATCCAGCAGGTTTCGACCTTCGCCATCAACTACCAGGGCCGTCCCTTTCGCGAATCTCTGTCGGAG
AATAGGGTCATGTTTTACGGCATCGTCGGCGTGTCGAGTCTCGCCTTTGTGTGTGCGCTGGAGCTGGTGCCGGAG
ATTAACGAGGCGATGAAGCTCGTGCGTTTCACCGAGGAGTTCAAGGTGAAGATGGCGGGCAGCATGGTTGTCGAC
TACCTGGCCTGCTTCGTCATCGAAAAGATGTTGAAGGCAACCTTTAGCGACTACCGCCCACGCGACATTGCGGAC
CGACGGCCCGAGCAGCTCGAGCGCGAGACGGTACGCAAGAAGGTGCTGGAGCGCAAGAAGGCCGACGAGGAGGAG
AGGAAGCGGATGGAGAAGGTGGCCGAGTTCGAGCGACAGGTCGAGGAACGCAAGCGGAAGCTGCGCGAGTGGCGG
AACGGCCAGCAGCGGACGGGTTAA

© 2022 - Robin Ohm - Utrecht University - The Netherlands

Built with Python Django and Wagtail