Fungal Genomics

at Utrecht University

General Properties

Protein IDOphcf2|00684
Gene name
Locationscaffold_01:2608144..2609292
Strand-
Gene length (bp)1148
Transcript length (bp)978
Coding sequence length (bp)978
Protein length (aa) 326

Overview

Your browser does not support drawing a protein figure.

PFAM Domains

PFAM Domain ID Short name Long name E-value Start End
PF08241 Methyltransf_11 Methyltransferase domain 2.5E-17 91 209
PF13489 Methyltransf_23 Methyltransferase domain 5.6E-16 81 256
PF13649 Methyltransf_25 Methyltransferase domain 2.9E-15 90 205
PF13847 Methyltransf_31 Methyltransferase domain 3.9E-13 87 213
PF02353 CMAS Mycolic acid cyclopropane synthetase 5.6E-11 31 131
PF08242 Methyltransf_12 Methyltransferase domain 3.0E-12 91 207
PF01209 Ubie_methyltran ubiE/COQ5 methyltransferase family 6.9E-05 87 210

GO

GO Term Description Terminal node
GO:0008168 methyltransferase activity Yes
GO:0003824 catalytic activity No
GO:0003674 molecular_function No
GO:0016741 transferase activity, transferring one-carbon groups No
GO:0016740 transferase activity No

Deeploc

[Help with interpreting the results of Deeploc 2.0]
Localizations Signals Cytoplasm Nucleus Extracellular Cell membrane Mitochondrion Plastid Endoplasmic reticulum Lysosome vacuole Golgi apparatus Peroxisome
Endoplasmic reticulum 0.4539 0.1707 0.141 0.035 0.401 0.4891 0.5863 0.2948 0.4258 0.0567

SignalP

(None)

Transmembrane Domains

(None)

Transcription Factor Class

(None)

CAZymes

(None)

Secondary Metabolism

(None)

Expression data

Analysis 1: Expression analysis during behavioral modification. Published in: Will et al., G3, 2020

Click here for more information

Orthologs

Orthofinder run ID4
Orthogroup6541
Change Orthofinder run
Species Protein ID
Ophiocordyceps camponoti-floridani Ophcf2|00684 (this protein)
Ophiocordyceps camponoti-rufipedis Ophun1|4359
Ophiocordyceps kimflemingae Ophio5|8563
Ophiocordyceps subramaniannii Hirsu2|1816

Sequences

Type of sequenceSequence
Locus Download genbank file of locus Download genbank file of locus (reverse complement)
The gene with 5 kb flanks (if sufficient flanking sequence is available). For use in cloning design programs. NOTE: features (genes or exons) that are only partially contained within the sequence are completely excluded.
Protein >Ophcf2|00684
MSAPESSTPLSRQYEMQLGQPHEEMEALKGKIKQHYDIASDSYLDIWGEHIHHGYWPTPESEAKDSKETAELNLV
KLLLSISKLEINASVLDVGCGVGGSARHLASQLGCNVTGITISSRQVELAYKLSEAEAGGDAESAVDGNSVRLGS
GKVRFLEMDAETMADHFGRGEAGTFDVVWIVEALSHFPNKALFFENAFRVLRPGGKLVLADWFKADGLDAEALRN
EIKPIEDGMLLPPLCTQMDYVQLAKTTGLAVFAEPMDISNQVRKTWDLTWSMIQKPSLWQFALSHGRDALAFLQS
FRAMRSGYYKGSFRYAVMTFQKPEA*
Coding >Ophcf2|00684
ATGTCCGCCCCCGAAAGCAGCACGCCGCTCAGCAGGCAGTATGAGATGCAGCTGGGACAGCCACACGAAGAGATG
GAGGCTCTCAAGGGTAAGATCAAGCAGCACTACGACATTGCCAGCGATAGCTATCTCGATATCTGGGGCGAGCAC
ATCCACCACGGTTACTGGCCGACACCGGAGTCGGAGGCCAAGGACAGCAAGGAGACGGCCGAGCTGAACCTCGTC
AAGCTCCTCCTCTCCATCTCCAAGCTCGAGATCAACGCCTCCGTCCTCGACGTCGGTTGCGGCGTCGGCGGTTCG
GCCCGTCACCTCGCCTCCCAGCTCGGCTGCAACGTAACGGGCATCACCATCTCGTCCCGACAGGTCGAGCTAGCC
TATAAACTCTCCGAAGCCGAGGCCGGAGGCGACGCCGAGTCTGCCGTCGACGGGAACTCGGTCCGTCTGGGCTCC
GGAAAGGTCCGCTTCCTCGAGATGGACGCCGAGACCATGGCGGATCATTTCGGTCGCGGCGAGGCCGGCACCTTT
GACGTCGTCTGGATCGTCGAGGCCCTCAGTCACTTTCCCAACAAGGCGCTGTTCTTTGAGAATGCCTTTCGGGTC
CTTCGGCCCGGCGGGAAGCTCGTCTTGGCCGACTGGTTCAAGGCCGATGGGCTGGACGCCGAGGCGCTGCGCAAC
GAGATTAAGCCCATCGAAGACGGCATGCTTCTCCCGCCTCTCTGCACGCAAATGGACTATGTCCAGCTCGCCAAA
ACGACAGGGCTTGCCGTCTTTGCCGAGCCCATGGACATCAGCAACCAAGTCCGCAAGACGTGGGACTTGACCTGG
TCGATGATTCAGAAGCCGTCCCTCTGGCAGTTTGCGCTCTCGCACGGCAGAGATGCCCTGGCTTTTCTCCAGAGC
TTCCGGGCCATGCGAAGCGGCTACTACAAGGGGAGCTTCCGGTATGCCGTCATGACGTTTCAGAAGCCGGAGGCG
TAG
Transcript >Ophcf2|00684
ATGTCCGCCCCCGAAAGCAGCACGCCGCTCAGCAGGCAGTATGAGATGCAGCTGGGACAGCCACACGAAGAGATG
GAGGCTCTCAAGGGTAAGATCAAGCAGCACTACGACATTGCCAGCGATAGCTATCTCGATATCTGGGGCGAGCAC
ATCCACCACGGTTACTGGCCGACACCGGAGTCGGAGGCCAAGGACAGCAAGGAGACGGCCGAGCTGAACCTCGTC
AAGCTCCTCCTCTCCATCTCCAAGCTCGAGATCAACGCCTCCGTCCTCGACGTCGGTTGCGGCGTCGGCGGTTCG
GCCCGTCACCTCGCCTCCCAGCTCGGCTGCAACGTAACGGGCATCACCATCTCGTCCCGACAGGTCGAGCTAGCC
TATAAACTCTCCGAAGCCGAGGCCGGAGGCGACGCCGAGTCTGCCGTCGACGGGAACTCGGTCCGTCTGGGCTCC
GGAAAGGTCCGCTTCCTCGAGATGGACGCCGAGACCATGGCGGATCATTTCGGTCGCGGCGAGGCCGGCACCTTT
GACGTCGTCTGGATCGTCGAGGCCCTCAGTCACTTTCCCAACAAGGCGCTGTTCTTTGAGAATGCCTTTCGGGTC
CTTCGGCCCGGCGGGAAGCTCGTCTTGGCCGACTGGTTCAAGGCCGATGGGCTGGACGCCGAGGCGCTGCGCAAC
GAGATTAAGCCCATCGAAGACGGCATGCTTCTCCCGCCTCTCTGCACGCAAATGGACTATGTCCAGCTCGCCAAA
ACGACAGGGCTTGCCGTCTTTGCCGAGCCCATGGACATCAGCAACCAAGTCCGCAAGACGTGGGACTTGACCTGG
TCGATGATTCAGAAGCCGTCCCTCTGGCAGTTTGCGCTCTCGCACGGCAGAGATGCCCTGGCTTTTCTCCAGAGC
TTCCGGGCCATGCGAAGCGGCTACTACAAGGGGAGCTTCCGGTATGCCGTCATGACGTTTCAGAAGCCGGAGGCG
TAG
Gene >Ophcf2|00684
ATGTCCGCCCCCGAAAGCAGCACGCCGCTCAGCAGGCAGTATGAGATGCAGCTGGGACAGCCACACGAAGAGATG
GAGGCTCTCAAGGGTAAGATCAAGCAGCACTACGACATTGCCAGCGATAGCTATCTCGATATCTGGTAAATTAGT
CGCGGGCATCGGAAGAAGGCGGCACGGAGCTCTGACGCAGACATTCAGGGGCGAGCACATCCACCACGGTTACTG
GCCGACACCGGAGTCGGAGGCCAAGGACAGCAAGGAGACGGCCGAGCTGAACCTCGTCAAGCTCCTCCTCTCCAT
CTCCAAGCTCGAGATCAACGCCTCCGTCCTCGACGTCGGTTGCGGCGTCGGCGGTTCGGCCCGTCACCTCGCCTC
CCAGCTCGGCTGCAACGTAACGGGCATCACCATCTCGTCCCGACAGGTCGAGCTAGCCTATAAACTCTCCGAAGC
CGAGGCCGGAGGCGACGCCGAGTCTGCCGTCGACGGGAACTCGGTCCGTCTGGGCTCCGGAAAGGTCCGCTTCCT
CGAGATGGACGCCGAGACCATGGCGGATCATTTCGGTCGCGGCGAGGCCGGCACCTTTGACGTCGTCTGGATCGT
CGAGGCCCTCAGTCACTTTCCCAACAAGGCGCTGTTCTTTGAGAATGCCTTTCGGGTCCTTCGGCCCGGCGGGAA
GCTCGTCTTGGCCGACTGGTTCAAGGCCGATGGGCTGGACGCCGAGGCGCTGCGCAACGAGATTAAGCCCATCGA
AGGTGAGTAGGGGGTTTGGCCCGGGACGAGACTGTCTGCTAATCATCTTAAAGACGGCATGCTTCTCCCGCCTCT
CTGCACGCAAATGGACTATGTCCAGCTCGCCAAAACGACAGGGCTTGCCGTCTTTGCCGAGCCCATGGACATCAG
CAACCAAGTCCGCAAGACGTGGTGAGTGACGACGAGCCTTTTTACGGTCCCGCCGCGTCTGTTGTCTGACGCTGT
GATACAGGGACTTGACCTGGTCGATGATTCAGAAGCCGTCCCTCTGGCAGTTTGCGCTCTCGCACGGCAGAGATG
CCCTGGCTTTTCTCCAGAGCTTCCGGGCCATGCGAAGCGGCTACTACAAGGGGAGCTTCCGGTATGCCGTCATGA
CGTTTCAGAAGCCGGAGGCGTAG

© 2023 - Robin Ohm - Utrecht University - The Netherlands

Built with Python Django and Wagtail