Fungal Genomics

at Utrecht University

General Properties

Protein IDOphcf2|00681
Gene name
Locationscaffold_01:2603462..2604736
Strand+
Gene length (bp)1274
Transcript length (bp)1212
Coding sequence length (bp)1212
Protein length (aa) 404

Overview

Your browser does not support drawing a protein figure.

PFAM Domains

PFAM Domain ID Short name Long name E-value Start End
PF00195 Chal_sti_synt_N Chalcone and stilbene synthases, N-terminal domain 3.6E-20 72 221
PF02797 Chal_sti_synt_C Chalcone and stilbene synthases, C-terminal domain 1.5E-19 239 384
PF08392 FAE1_CUT1_RppA FAE1/Type III polyketide synthase-like protein 4.3E-07 97 235

GO

GO Term Description Terminal node
GO:0016747 acyltransferase activity, transferring groups other than amino-acyl groups Yes
GO:0006633 fatty acid biosynthetic process Yes
GO:0016020 membrane Yes
GO:0008152 metabolic process No
GO:0044283 small molecule biosynthetic process No
GO:0003824 catalytic activity No
GO:1901576 organic substance biosynthetic process No
GO:0009058 biosynthetic process No
GO:0016746 acyltransferase activity No
GO:0016740 transferase activity No
GO:0044255 cellular lipid metabolic process No
GO:0044238 primary metabolic process No
GO:0019752 carboxylic acid metabolic process No
GO:0009987 cellular process No
GO:0043436 oxoacid metabolic process No
GO:0110165 cellular anatomical entity No
GO:0044237 cellular metabolic process No
GO:0044281 small molecule metabolic process No
GO:0016053 organic acid biosynthetic process No
GO:0005575 cellular_component No
GO:0006629 lipid metabolic process No
GO:0003674 molecular_function No
GO:0008610 lipid biosynthetic process No
GO:0072330 monocarboxylic acid biosynthetic process No
GO:0032787 monocarboxylic acid metabolic process No
GO:0044249 cellular biosynthetic process No
GO:0046394 carboxylic acid biosynthetic process No
GO:0006082 organic acid metabolic process No
GO:0008150 biological_process No
GO:0006631 fatty acid metabolic process No
GO:0071704 organic substance metabolic process No

Deeploc

[Help with interpreting the results of Deeploc 2.0]
Localizations Signals Cytoplasm Nucleus Extracellular Cell membrane Mitochondrion Plastid Endoplasmic reticulum Lysosome vacuole Golgi apparatus Peroxisome
Cytoplasm 0.4916 0.4506 0.0851 0.0188 0.5833 0.0203 0.3559 0.1935 0.0821 0.2253

SignalP

(None)

Transmembrane Domains

(None)

Transcription Factor Class

(None)

CAZymes

(None)

Secondary Metabolism

(None)

Expression data

Analysis 1: Expression analysis during behavioral modification. Published in: Will et al., G3, 2020

Click here for more information

Orthologs

Orthofinder run ID4
Orthogroup6044
Change Orthofinder run
Species Protein ID
Ophiocordyceps camponoti-floridani Ophcf2|00681 (this protein)
Ophiocordyceps camponoti-rufipedis Ophun1|4357
Ophiocordyceps kimflemingae Ophio5|5604
Ophiocordyceps subramaniannii Hirsu2|1821

Sequences

Type of sequenceSequence
Locus Download genbank file of locus Download genbank file of locus (reverse complement)
The gene with 5 kb flanks (if sufficient flanking sequence is available). For use in cloning design programs. NOTE: features (genes or exons) that are only partially contained within the sequence are completely excluded.
Protein >Ophcf2|00681
MASTNIFHPELRLSITGLGTQYPENSFGPDTVEQIARDHYQPSPSLDKIVSINKFTGIETRSTIAFKTNQLLSQP
TPPSISELHQAFVQHGIPLAVSAAAKAIRESGLDVGQITHMVSSTCTDSANPGFDHVVARELGLADDVEKVLLGG
VGCSGGLAALRTGANLALGHAALGRPARVLCLALEITTLLVRSELDSVDQRQEVRIGVCLFSDAASAVVLSNGIG
EQAEAVYQLLGWHHRIVPDTEHELGFDVDPLGWKVILTPRVPEHTKAAIGPSFERLKASLPHLPRHISEARDFDW
ALHPGGAAILSGTEEALGIPACHLRASYDVYVRHGNSSSATIFSVLDRLRSRDMDRLAPDGGRRQHVVACAFGPG
IAVEMCMLKRNLALGQDTPSPDTADEAI*
Coding >Ophcf2|00681
ATGGCGTCGACCAACATCTTCCACCCGGAGCTTCGGCTCTCCATTACAGGCTTGGGCACGCAGTATCCCGAGAAC
TCGTTTGGCCCGGATACCGTCGAGCAGATTGCCAGAGACCACTATCAGCCGTCGCCCAGCCTCGACAAGATCGTC
TCCATCAACAAATTCACCGGCATCGAGACACGATCAACCATCGCCTTCAAGACGAACCAGCTCCTCTCCCAACCA
ACACCACCCTCGATATCGGAACTACACCAAGCCTTCGTACAACACGGAATCCCCCTCGCCGTCAGCGCCGCCGCA
AAAGCCATACGCGAATCCGGCCTCGACGTCGGCCAAATCACGCACATGGTATCATCGACATGCACCGACAGCGCG
AACCCGGGCTTCGACCATGTCGTCGCTCGCGAGCTGGGACTGGCCGATGACGTGGAAAAGGTGCTGCTGGGCGGC
GTCGGCTGCAGCGGCGGACTCGCGGCCCTGAGGACGGGCGCCAACCTCGCTCTCGGACACGCGGCCCTGGGGAGA
CCGGCCAGGGTGCTGTGTCTGGCGCTGGAGATCACCACCCTGCTGGTCCGTAGCGAACTCGACAGCGTCGACCAG
CGGCAAGAGGTCCGGATAGGCGTCTGTCTGTTCTCGGACGCTGCCAGCGCCGTCGTCTTATCCAACGGCATCGGA
GAGCAGGCCGAAGCCGTCTACCAGCTTCTCGGCTGGCATCACCGCATCGTGCCGGACACGGAGCACGAGCTGGGC
TTCGACGTCGATCCTCTCGGCTGGAAGGTGATTCTGACTCCCCGAGTACCGGAGCACACCAAGGCGGCAATCGGT
CCCTCGTTCGAGAGACTCAAGGCCTCGCTGCCCCATCTGCCTCGTCACATCAGCGAAGCCCGCGACTTCGACTGG
GCCCTGCATCCGGGGGGCGCAGCCATCCTTTCGGGCACGGAAGAGGCGCTGGGGATACCGGCCTGTCACCTGCGA
GCCAGCTACGACGTCTACGTCCGGCACGGGAACTCGAGCTCGGCCACCATCTTCAGCGTCCTCGACCGGCTGAGG
TCAAGGGACATGGACCGGCTGGCTCCCGATGGCGGTAGACGGCAGCATGTCGTTGCCTGTGCTTTCGGGCCGGGC
ATCGCCGTCGAGATGTGCATGTTGAAGCGCAATCTGGCGCTCGGGCAGGATACGCCGAGTCCGGACACGGCCGAC
GAGGCCATCTAG
Transcript >Ophcf2|00681
ATGGCGTCGACCAACATCTTCCACCCGGAGCTTCGGCTCTCCATTACAGGCTTGGGCACGCAGTATCCCGAGAAC
TCGTTTGGCCCGGATACCGTCGAGCAGATTGCCAGAGACCACTATCAGCCGTCGCCCAGCCTCGACAAGATCGTC
TCCATCAACAAATTCACCGGCATCGAGACACGATCAACCATCGCCTTCAAGACGAACCAGCTCCTCTCCCAACCA
ACACCACCCTCGATATCGGAACTACACCAAGCCTTCGTACAACACGGAATCCCCCTCGCCGTCAGCGCCGCCGCA
AAAGCCATACGCGAATCCGGCCTCGACGTCGGCCAAATCACGCACATGGTATCATCGACATGCACCGACAGCGCG
AACCCGGGCTTCGACCATGTCGTCGCTCGCGAGCTGGGACTGGCCGATGACGTGGAAAAGGTGCTGCTGGGCGGC
GTCGGCTGCAGCGGCGGACTCGCGGCCCTGAGGACGGGCGCCAACCTCGCTCTCGGACACGCGGCCCTGGGGAGA
CCGGCCAGGGTGCTGTGTCTGGCGCTGGAGATCACCACCCTGCTGGTCCGTAGCGAACTCGACAGCGTCGACCAG
CGGCAAGAGGTCCGGATAGGCGTCTGTCTGTTCTCGGACGCTGCCAGCGCCGTCGTCTTATCCAACGGCATCGGA
GAGCAGGCCGAAGCCGTCTACCAGCTTCTCGGCTGGCATCACCGCATCGTGCCGGACACGGAGCACGAGCTGGGC
TTCGACGTCGATCCTCTCGGCTGGAAGGTGATTCTGACTCCCCGAGTACCGGAGCACACCAAGGCGGCAATCGGT
CCCTCGTTCGAGAGACTCAAGGCCTCGCTGCCCCATCTGCCTCGTCACATCAGCGAAGCCCGCGACTTCGACTGG
GCCCTGCATCCGGGGGGCGCAGCCATCCTTTCGGGCACGGAAGAGGCGCTGGGGATACCGGCCTGTCACCTGCGA
GCCAGCTACGACGTCTACGTCCGGCACGGGAACTCGAGCTCGGCCACCATCTTCAGCGTCCTCGACCGGCTGAGG
TCAAGGGACATGGACCGGCTGGCTCCCGATGGCGGTAGACGGCAGCATGTCGTTGCCTGTGCTTTCGGGCCGGGC
ATCGCCGTCGAGATGTGCATGTTGAAGCGCAATCTGGCGCTCGGGCAGGATACGCCGAGTCCGGACACGGCCGAC
GAGGCCATCTAG
Gene >Ophcf2|00681
ATGGCGTCGACCAACATCTTCCACCCGGAGCTTCGGCTCTCCATTACAGGCTTGGGCACGCAGTATCCCGAGAAC
TCGTTTGGCCCGGATACCGTCGAGCAGATTGCCAGAGACCACTATCAGCCGTCGCCCAGGTGAGACTCGGGCCGT
GACACGGCGACGACTCCAGTCATGTTAACCACGAGGACGTGCACAGCCTCGACAAGATCGTCTCCATCAACAAAT
TCACCGGCATCGAGACACGATCAACCATCGCCTTCAAGACGAACCAGCTCCTCTCCCAACCAACACCACCCTCGA
TATCGGAACTACACCAAGCCTTCGTACAACACGGAATCCCCCTCGCCGTCAGCGCCGCCGCAAAAGCCATACGCG
AATCCGGCCTCGACGTCGGCCAAATCACGCACATGGTATCATCGACATGCACCGACAGCGCGAACCCGGGCTTCG
ACCATGTCGTCGCTCGCGAGCTGGGACTGGCCGATGACGTGGAAAAGGTGCTGCTGGGCGGCGTCGGCTGCAGCG
GCGGACTCGCGGCCCTGAGGACGGGCGCCAACCTCGCTCTCGGACACGCGGCCCTGGGGAGACCGGCCAGGGTGC
TGTGTCTGGCGCTGGAGATCACCACCCTGCTGGTCCGTAGCGAACTCGACAGCGTCGACCAGCGGCAAGAGGTCC
GGATAGGCGTCTGTCTGTTCTCGGACGCTGCCAGCGCCGTCGTCTTATCCAACGGCATCGGAGAGCAGGCCGAAG
CCGTCTACCAGCTTCTCGGCTGGCATCACCGCATCGTGCCGGACACGGAGCACGAGCTGGGCTTCGACGTCGATC
CTCTCGGCTGGAAGGTGATTCTGACTCCCCGAGTACCGGAGCACACCAAGGCGGCAATCGGTCCCTCGTTCGAGA
GACTCAAGGCCTCGCTGCCCCATCTGCCTCGTCACATCAGCGAAGCCCGCGACTTCGACTGGGCCCTGCATCCGG
GGGGCGCAGCCATCCTTTCGGGCACGGAAGAGGCGCTGGGGATACCGGCCTGTCACCTGCGAGCCAGCTACGACG
TCTACGTCCGGCACGGGAACTCGAGCTCGGCCACCATCTTCAGCGTCCTCGACCGGCTGAGGTCAAGGGACATGG
ACCGGCTGGCTCCCGATGGCGGTAGACGGCAGCATGTCGTTGCCTGTGCTTTCGGGCCGGGCATCGCCGTCGAGA
TGTGCATGTTGAAGCGCAATCTGGCGCTCGGGCAGGATACGCCGAGTCCGGACACGGCCGACGAGGCCATCTAG

© 2023 - Robin Ohm - Utrecht University - The Netherlands

Built with Python Django and Wagtail