Fungal Genomics

at Utrecht University

General Properties

Protein IDOphcf2|00675
Gene name
Locationscaffold_01:2590134..2591677
Strand-
Gene length (bp)1543
Transcript length (bp)1284
Coding sequence length (bp)1284
Protein length (aa) 428

Overview

Your browser does not support drawing a protein figure.

PFAM Domains

PFAM Domain ID Short name Long name E-value Start End
PF03069 FmdA_AmdA Acetamidase/Formamidase family 5.5E-172 30 406

GO

GO Term Description Terminal node
GO:0016811 hydrolase activity, acting on carbon-nitrogen (but not peptide) bonds, in linear amides Yes
GO:0016810 hydrolase activity, acting on carbon-nitrogen (but not peptide) bonds No
GO:0003824 catalytic activity No
GO:0003674 molecular_function No
GO:0016787 hydrolase activity No

Deeploc

[Help with interpreting the results of Deeploc 2.0]
Localizations Signals Cytoplasm Nucleus Extracellular Cell membrane Mitochondrion Plastid Endoplasmic reticulum Lysosome vacuole Golgi apparatus Peroxisome
Cytoplasm|Nucleus 0.4966 0.7155 0.0404 0.2484 0.2086 0.0092 0.0932 0.1199 0.0245 0.1293

SignalP

(None)

Transmembrane Domains

(None)

Transcription Factor Class

(None)

CAZymes

(None)

Secondary Metabolism

(None)

Expression data

Analysis 1: Expression analysis during behavioral modification. Published in: Will et al., G3, 2020

Click here for more information

Orthologs

Orthofinder run ID4
Orthogroup4476
Change Orthofinder run
Species Protein ID
Ophiocordyceps australis 1348a (Ghana) OphauG2|6040
Ophiocordyceps australis map64 (Brazil) OphauB2|120
Ophiocordyceps camponoti-floridani Ophcf2|00675 (this protein)
Ophiocordyceps camponoti-rufipedis Ophun1|4351
Ophiocordyceps kimflemingae Ophio5|5599
Ophiocordyceps subramaniannii Hirsu2|9328

Sequences

Type of sequenceSequence
Locus Download genbank file of locus Download genbank file of locus (reverse complement)
The gene with 5 kb flanks (if sufficient flanking sequence is available). For use in cloning design programs. NOTE: features (genes or exons) that are only partially contained within the sequence are completely excluded.
Protein >Ophcf2|00675
MQTSLLSRQRPVSGNPYITITINITITIPASQQANLHNRWHPDIPSIETIKPGETVKIECLDWTGGQIENNDCAD
DVRHVDLTKVHYLTGPFDIEGSEPGDLLVVNITDIQPFEHQPWGFTGIFSRENGGGFLDRHYPRAAKAIWDFDGI
YCSSRHIPGVRFAGLVHPGILGCAPSAELLAEWNGREGELVSACNKESHPGQVVALMPDRDGAHAGGAGGELYER
IAREGARTIPGRPEHGGNVDINNISRGSTTYLPVHVPGAKFSVGDVHFSQGDGEISFCGAIEMAGIITVNLSLIK
NGVRERAVKSPVFRPGDVAQLFGPSRYLTFEGFSVDEKGKQHFLDATVAYRQACLRAIEYLKQFGYSGEQAYLLL
SCAPIRGSIAGIVDVPNACTTLGLPMDIFDFDISVEAPRRSRDVGSCALTSQ*
Coding >Ophcf2|00675
ATGCAGACATCTCTATTGAGTCGTCAGAGGCCAGTCTCTGGCAACCCATATATCACCATCACCATCAACATCACC
ATCACCATCCCGGCATCTCAGCAGGCGAATCTGCACAATCGCTGGCATCCAGACATCCCGTCCATCGAGACCATC
AAGCCCGGAGAGACGGTCAAGATTGAATGCCTCGACTGGACGGGAGGCCAGATCGAGAACAACGACTGCGCAGAC
GACGTCCGCCATGTAGACCTCACAAAAGTCCACTACCTGACGGGCCCCTTTGACATAGAGGGCAGCGAGCCGGGC
GATCTCTTGGTGGTCAACATCACCGACATCCAGCCCTTTGAGCACCAGCCTTGGGGCTTCACCGGCATCTTTTCT
CGAGAAAACGGCGGCGGTTTCCTCGACAGGCACTATCCCCGAGCGGCAAAGGCCATCTGGGACTTTGACGGTATC
TACTGCTCCAGCCGGCACATCCCTGGCGTCCGCTTCGCCGGCCTCGTCCATCCGGGCATCCTCGGCTGTGCCCCG
TCCGCCGAGCTGCTGGCCGAGTGGAACGGGCGTGAGGGCGAGCTGGTTTCGGCATGTAATAAGGAGTCTCATCCG
GGGCAGGTCGTTGCCCTGATGCCCGACCGAGACGGCGCCCACGCGGGTGGTGCCGGCGGTGAGCTCTACGAGAGG
ATCGCTAGGGAGGGCGCGAGGACGATCCCTGGACGGCCCGAGCACGGGGGGAACGTCGACATCAATAACATCTCT
CGAGGATCAACCACTTACCTGCCCGTACACGTACCGGGAGCCAAGTTCTCGGTGGGAGACGTCCATTTCAGCCAG
GGAGATGGCGAGATCAGCTTCTGCGGGGCCATAGAGATGGCCGGCATCATCACCGTCAACCTGAGCCTCATCAAG
AACGGCGTCCGAGAGCGTGCCGTCAAGAGCCCCGTCTTCCGGCCGGGCGACGTCGCCCAGCTGTTCGGCCCGTCC
CGATACCTGACCTTTGAGGGCTTCTCCGTCGATGAAAAGGGGAAGCAGCACTTCCTCGACGCCACCGTCGCCTAT
CGCCAAGCCTGTCTCCGGGCCATCGAGTATCTGAAACAGTTTGGCTACTCGGGCGAACAGGCCTATCTCCTCCTG
TCATGCGCGCCGATCCGAGGCTCCATCGCGGGCATCGTCGATGTTCCCAACGCTTGTACGACGCTGGGGCTTCCC
ATGGACATTTTCGACTTTGACATCTCGGTAGAGGCCCCGAGGCGGAGCAGGGATGTGGGATCGTGCGCCTTGACG
AGCCAGTAG
Transcript >Ophcf2|00675
ATGCAGACATCTCTATTGAGTCGTCAGAGGCCAGTCTCTGGCAACCCATATATCACCATCACCATCAACATCACC
ATCACCATCCCGGCATCTCAGCAGGCGAATCTGCACAATCGCTGGCATCCAGACATCCCGTCCATCGAGACCATC
AAGCCCGGAGAGACGGTCAAGATTGAATGCCTCGACTGGACGGGAGGCCAGATCGAGAACAACGACTGCGCAGAC
GACGTCCGCCATGTAGACCTCACAAAAGTCCACTACCTGACGGGCCCCTTTGACATAGAGGGCAGCGAGCCGGGC
GATCTCTTGGTGGTCAACATCACCGACATCCAGCCCTTTGAGCACCAGCCTTGGGGCTTCACCGGCATCTTTTCT
CGAGAAAACGGCGGCGGTTTCCTCGACAGGCACTATCCCCGAGCGGCAAAGGCCATCTGGGACTTTGACGGTATC
TACTGCTCCAGCCGGCACATCCCTGGCGTCCGCTTCGCCGGCCTCGTCCATCCGGGCATCCTCGGCTGTGCCCCG
TCCGCCGAGCTGCTGGCCGAGTGGAACGGGCGTGAGGGCGAGCTGGTTTCGGCATGTAATAAGGAGTCTCATCCG
GGGCAGGTCGTTGCCCTGATGCCCGACCGAGACGGCGCCCACGCGGGTGGTGCCGGCGGTGAGCTCTACGAGAGG
ATCGCTAGGGAGGGCGCGAGGACGATCCCTGGACGGCCCGAGCACGGGGGGAACGTCGACATCAATAACATCTCT
CGAGGATCAACCACTTACCTGCCCGTACACGTACCGGGAGCCAAGTTCTCGGTGGGAGACGTCCATTTCAGCCAG
GGAGATGGCGAGATCAGCTTCTGCGGGGCCATAGAGATGGCCGGCATCATCACCGTCAACCTGAGCCTCATCAAG
AACGGCGTCCGAGAGCGTGCCGTCAAGAGCCCCGTCTTCCGGCCGGGCGACGTCGCCCAGCTGTTCGGCCCGTCC
CGATACCTGACCTTTGAGGGCTTCTCCGTCGATGAAAAGGGGAAGCAGCACTTCCTCGACGCCACCGTCGCCTAT
CGCCAAGCCTGTCTCCGGGCCATCGAGTATCTGAAACAGTTTGGCTACTCGGGCGAACAGGCCTATCTCCTCCTG
TCATGCGCGCCGATCCGAGGCTCCATCGCGGGCATCGTCGATGTTCCCAACGCTTGTACGACGCTGGGGCTTCCC
ATGGACATTTTCGACTTTGACATCTCGGTAGAGGCCCCGAGGCGGAGCAGGGATGTGGGATCGTGCGCCTTGACG
AGCCAGTAG
Gene >Ophcf2|00675
ATGCAGACATCTCTATTGAGTCGTCAGAGGCCAGGTATAAATACCCTTTAACGAAGCCGTTCAGCCACAGCGGGG
TATAAATCGGTCTGCAGCTGAGCCAGAGTCTTGTGTAACAGTCTCTGGCAACCCATATATCACCATCACCATCAA
CATCACCATCACCGTGCATCATGACAACACCGACAAAGATCCGCACCGTTCAGCCCGTCTCCTTTCAGATCCCGG
CATCTCAGCAGGCGAATCTGCACAATCGCTGGCATCCAGACAGTTGAGACAATCTCTCCCCCCCCCCCCGGATGA
CGAGCTGACGACGAAGCCAGTCCCGTCCATCGAGACCATCAAGCCCGGAGAGACGGTCAAGATTGAATGCCTCGA
CTGGACGGGAGGCCAGATCGAGAACAACGACTGCGCAGACGACGTCCGCCATGTAGACCTCACAAAAGTCCACTA
CCTGACGGGCCCCTTTGACATAGAGGGCAGCGAGCCGGGCGATCTCTTGGTGGTCAACATCACCGACATCCAGCC
CTTTGAGCACCAGCCTTGGGGCTTCACCGGCATCTTTTCTCGAGAAAACGGCGGCGGTTTCCTCGACAGGCACTA
TCCCCGAGCGGCAAAGGCCATCTGGGACTTTGACGGTATCTACTGCTCCAGCCGGCACATCCCTGGCGTCCGCTT
CGCCGGCCTCGTCCATCCGGGCATCCTCGGCTGTGCCCCGTCCGCCGAGCTGCTGGCCGAGTGGAACGGGCGTGA
GGGCGAGCTGGTTTCGGCATGTAATAAGGAGTCTCATCCGGGGCAGGTCGTTGCCCTGATGCCCGACCGAGACGG
CGCCCACGCGGGTGGTGCCGGCGGTGAGCTCTACGAGAGGATCGCTAGGGAGGGCGCGAGGACGATCCCTGGACG
GCCCGAGCACGGGGGGAACGTCGACATCAATAACATCTCTCGAGGATCAACCACTTACCTGCCCGTACACGTACC
GGGAGCCAAGTTCTCGGTGGGAGACGTCCATTTCAGCCAGGGAGATGGCGAGATCAGCTTCTGCGGGGCCATAGA
GATGGCCGGCATCATCACCGTCAACCTGAGCCTCATCAAGAACGGCGTCCGAGAGCGTGCCGTCAAGAGCCCCGT
CTTCCGGCCGGGCGACGTCGCCCAGCTGTTCGGCCCGTCCCGATACCTGACCTTTGAGGGCTTCTCCGTCGATGA
AAAGGGGAAGCAGCACTTCCTCGACGCCACCGTCGCCTATCGCCAAGCCTGTCTCCGGGCCATCGAGTATCTGAA
ACAGTTTGGTGAGACGACGGCGGCTTCGTCTTCAACTCGTCTACGGGGCCCGCACCGGACTGACTATTGTTTTCC
AGGCTACTCGGGCGAACAGGCCTATCTCCTCCTGTCATGCGCGCCGATCCGAGGCTCCATCGCGGGCATCGTCGA
TGTTCCCAACGCTTGTACGACGCTGGGGCTTCCCATGGACATTTTCGACTTTGACATCTCGGTAGAGGCCCCGAG
GCGGAGCAGGGATGTGGGATCGTGCGCCTTGACGAGCCAGTAG

© 2023 - Robin Ohm - Utrecht University - The Netherlands

Built with Python Django and Wagtail