Fungal Genomics

at Utrecht University

General Properties

Protein IDOphcf2|00671
Gene name
Locationscaffold_01:2577130..2581083
Strand-
Gene length (bp)3953
Transcript length (bp)2490
Coding sequence length (bp)2490
Protein length (aa) 830

Your browser does not support drawing a protein figure.

PFAM Domains

PFAM Domain ID Short name Long name E-value Start End
PF00106 adh_short short chain dehydrogenase 4.7E-26 2 167
PF12776 Myb_DNA-bind_3 Myb/SANT-like DNA-binding domain 2.1E-22 299 393
PF13561 adh_short_C2 Enoyl-(Acyl carrier protein) reductase 5.2E-21 2 172

GO

(None)

SignalP

[Help with interpreting these statistics]
SignalP signal predicted Location
(based on Ymax)
D score
(significance: > 0.45)
No 1 - 43 0.45

Transmembrane Domains

Domain # Start End Length
1 763 785 22
2 798 820 22

Transcription Factor Class

(None)

Expression data

Analysis 1: Expression analysis during behavioral modification. Published in: Will et al., G3, 2020

Click here for more information

Sequences

Type of sequenceSequence
Locus Download genbank file of locus
The gene with 5 kb flanks (if sufficient flanking sequence is available). For use in cloning design programs. NOTE: features (genes or exons) that are only partially contained within the sequence are completely excluded.
Protein >Ophcf2|00671
MRVCLADRDTTALQTAKGELERSAGKDVLALVSDVSKPASWAALNKDVTEAFGGVELLVLNAGMSANGGWGDEEY
FRKTLETNLFGVIYGINEFLPVVKAAAKSKPTAIVITGSKQGITNPPGNPAYNASKAAVKSLAEHLSWDLRNDKT
TVHLLVPGWTFTGITGGGRDKSKPPGAWTSEQVADYLYRKMGEDKFYAICPDNDVSEDMDKRRMLWTMGDVVEQR
PPLTRWREEWKQKAEDAMAKMKVSVCGREPLQAVLLPMRGIDEVDNMSEDDIDMLGSDGQSSRIDRDRRAPRFSW
SPAYEETFFRSLCDSVQLGLRENSSFKTEVWDRAAIALQEIHGTYPAKSHLINKSDNARKRFRLWRGLREDPDFV
YDPVERTVTASEDAWRAHIEREPLSRALRGRSFAHEDFMEILYPDVIGSGGAPKRIMKTRRRVDGIIIDEVDTPG
AGVLSLQIDSSPSHAVEVAERQCAAPVMPSTSVSMPAWTATGQPGTDEPTNQAKKRAFPHDAAEGTTLAESPPSS
CFTSINVPAGSPGKRVRTAIQVDASSAGDSAIVTTGSASSLPAPSPSNTTPLSAPTVPAHVSEAAWEEPETTKNR
SGLQWQEMAVDLYFREFGHQDFDLQIRITDNAPHASSLFNPSPSRSIMSYAEVAASGPRQSSQEAAAPQPPEIIP
NESASTASLIDVDMPSVHTVRSDFLEQDVQTTTQAERRDREDEARKTNKARSARPSSSSASSSSPSVRGRADAWL
TGYFADLSDGSAGALAVANLAAVVGLSSYLGYKAWGLYDRGALDWKAAGLGVGILATVGAVESVVGGYLYKGKAK
KGSS*
Coding >Ophcf2|00671
ATGCGCGTATGTCTCGCTGACCGCGACACGACCGCCTTGCAGACAGCAAAGGGCGAACTTGAGAGATCAGCGGGG
AAAGACGTCCTGGCCCTAGTCTCCGATGTCAGCAAGCCTGCCTCGTGGGCAGCTCTCAACAAGGATGTGACAGAG
GCATTCGGCGGCGTCGAGCTGCTGGTCTTGAACGCGGGCATGTCTGCCAATGGGGGCTGGGGGGATGAAGAGTAT
TTCCGCAAGACGCTCGAGACGAATCTATTCGGAGTCATCTATGGCATCAATGAGTTTCTCCCGGTTGTCAAGGCA
GCAGCAAAGTCCAAGCCGACGGCCATTGTGATCACCGGGAGCAAGCAGGGCATCACCAACCCGCCCGGAAATCCG
GCATACAACGCCTCCAAGGCAGCCGTCAAGAGCCTCGCGGAGCATCTCAGCTGGGACTTGAGGAATGACAAGACG
ACAGTCCACCTGCTAGTCCCCGGCTGGACCTTTACCGGAATCACGGGCGGTGGCCGAGACAAAAGTAAGCCCCCG
GGGGCCTGGACTTCGGAGCAGGTGGCCGATTATCTATACCGGAAGATGGGTGAGGACAAGTTTTACGCCATTTGT
CCGGACAATGACGTTTCCGAGGATATGGACAAGAGGCGCATGCTTTGGACCATGGGCGACGTCGTCGAGCAACGG
CCTCCGCTCACGAGATGGCGTGAGGAATGGAAGCAGAAGGCGGAGGATGCCATGGCCAAGATGAAGGTGTCCGTT
TGCGGCCGCGAGCCTCTGCAGGCAGTGCTGCTTCCCATGCGAGGCATTGATGAGGTCGACAACATGTCCGAGGAC
GATATCGATATGCTTGGCTCGGACGGCCAGTCGTCTCGCATCGACCGTGACCGCCGGGCCCCGAGGTTCAGCTGG
AGTCCGGCCTACGAGGAGACCTTCTTCCGCAGCCTGTGCGACAGCGTCCAGCTGGGCCTGCGTGAGAATAGCAGC
TTCAAGACTGAGGTCTGGGATCGGGCAGCCATTGCGCTGCAGGAGATTCACGGCACGTATCCAGCCAAGAGCCAC
CTCATCAATAAGAGCGACAACGCCCGGAAGCGCTTCCGTTTGTGGAGGGGTCTGCGCGAGGACCCGGACTTTGTG
TACGATCCCGTTGAACGGACCGTGACAGCGTCGGAGGATGCCTGGCGGGCCCATATCGAGAGAGAACCGCTGTCG
CGCGCGCTGCGAGGACGATCGTTTGCTCACGAGGACTTCATGGAGATTCTCTACCCCGATGTCATCGGCTCCGGC
GGCGCCCCGAAGCGCATCATGAAGACCCGACGACGGGTCGATGGCATCATCATCGACGAGGTCGACACGCCCGGC
GCAGGCGTTTTGAGCTTGCAGATCGACTCGAGCCCGAGTCACGCCGTCGAAGTCGCAGAAAGGCAATGCGCGGCT
CCTGTGATGCCCTCGACGTCGGTCTCGATGCCCGCCTGGACGGCGACCGGCCAGCCAGGGACGGACGAGCCGACG
AATCAAGCCAAGAAACGCGCGTTTCCGCACGACGCTGCTGAAGGTACGACCCTCGCTGAATCGCCACCCTCATCG
TGCTTTACGTCGATAAATGTACCTGCCGGCTCGCCGGGGAAGCGGGTTCGCACGGCCATTCAGGTAGATGCATCA
TCTGCAGGAGACTCCGCCATCGTGACCACCGGCTCCGCATCGTCTCTTCCGGCGCCGAGCCCGTCAAACACGACG
CCCCTCTCGGCCCCCACCGTACCGGCCCACGTCTCTGAAGCGGCCTGGGAGGAGCCGGAAACCACCAAAAACAGA
TCCGGCCTCCAGTGGCAGGAGATGGCAGTGGACCTGTATTTTCGAGAATTCGGCCACCAAGACTTCGACCTGCAG
ATAAGGATCACGGACAACGCGCCTCACGCCTCGTCGCTCTTCAACCCATCTCCCTCGCGCAGCATCATGTCGTAC
GCCGAAGTCGCAGCCAGCGGGCCACGGCAATCCTCTCAAGAGGCTGCCGCTCCCCAGCCGCCAGAGATTATCCCC
AACGAGAGCGCATCGACAGCTTCACTCATAGACGTCGACATGCCCAGCGTTCACACCGTCCGCTCCGATTTCCTA
GAACAGGACGTCCAGACGACGACGCAAGCCGAGCGCCGCGACCGCGAAGACGAAGCCCGCAAGACCAACAAGGCT
CGGTCCGCTCGCCCCTCGTCCTCATCCGCCTCGTCGTCGTCGCCCTCGGTGCGCGGAAGGGCAGATGCCTGGCTG
ACCGGCTACTTCGCCGACTTGTCTGATGGGAGCGCCGGGGCCCTTGCCGTCGCGAATCTCGCTGCTGTCGTCGGT
CTTAGCTCCTACCTCGGCTACAAGGCTTGGGGCCTGTATGATCGAGGCGCGCTGGATTGGAAGGCTGCTGGCTTG
GGTGTGGGCATCTTGGCTACTGTTGGCGCTGTCGAGTCTGTTGTCGGCGGTTACTTGTACAAGGGCAAGGCGAAG
AAGGGCTCGTCGTAG
Transcript >Ophcf2|00671
ATGCGCGTATGTCTCGCTGACCGCGACACGACCGCCTTGCAGACAGCAAAGGGCGAACTTGAGAGATCAGCGGGG
AAAGACGTCCTGGCCCTAGTCTCCGATGTCAGCAAGCCTGCCTCGTGGGCAGCTCTCAACAAGGATGTGACAGAG
GCATTCGGCGGCGTCGAGCTGCTGGTCTTGAACGCGGGCATGTCTGCCAATGGGGGCTGGGGGGATGAAGAGTAT
TTCCGCAAGACGCTCGAGACGAATCTATTCGGAGTCATCTATGGCATCAATGAGTTTCTCCCGGTTGTCAAGGCA
GCAGCAAAGTCCAAGCCGACGGCCATTGTGATCACCGGGAGCAAGCAGGGCATCACCAACCCGCCCGGAAATCCG
GCATACAACGCCTCCAAGGCAGCCGTCAAGAGCCTCGCGGAGCATCTCAGCTGGGACTTGAGGAATGACAAGACG
ACAGTCCACCTGCTAGTCCCCGGCTGGACCTTTACCGGAATCACGGGCGGTGGCCGAGACAAAAGTAAGCCCCCG
GGGGCCTGGACTTCGGAGCAGGTGGCCGATTATCTATACCGGAAGATGGGTGAGGACAAGTTTTACGCCATTTGT
CCGGACAATGACGTTTCCGAGGATATGGACAAGAGGCGCATGCTTTGGACCATGGGCGACGTCGTCGAGCAACGG
CCTCCGCTCACGAGATGGCGTGAGGAATGGAAGCAGAAGGCGGAGGATGCCATGGCCAAGATGAAGGTGTCCGTT
TGCGGCCGCGAGCCTCTGCAGGCAGTGCTGCTTCCCATGCGAGGCATTGATGAGGTCGACAACATGTCCGAGGAC
GATATCGATATGCTTGGCTCGGACGGCCAGTCGTCTCGCATCGACCGTGACCGCCGGGCCCCGAGGTTCAGCTGG
AGTCCGGCCTACGAGGAGACCTTCTTCCGCAGCCTGTGCGACAGCGTCCAGCTGGGCCTGCGTGAGAATAGCAGC
TTCAAGACTGAGGTCTGGGATCGGGCAGCCATTGCGCTGCAGGAGATTCACGGCACGTATCCAGCCAAGAGCCAC
CTCATCAATAAGAGCGACAACGCCCGGAAGCGCTTCCGTTTGTGGAGGGGTCTGCGCGAGGACCCGGACTTTGTG
TACGATCCCGTTGAACGGACCGTGACAGCGTCGGAGGATGCCTGGCGGGCCCATATCGAGAGAGAACCGCTGTCG
CGCGCGCTGCGAGGACGATCGTTTGCTCACGAGGACTTCATGGAGATTCTCTACCCCGATGTCATCGGCTCCGGC
GGCGCCCCGAAGCGCATCATGAAGACCCGACGACGGGTCGATGGCATCATCATCGACGAGGTCGACACGCCCGGC
GCAGGCGTTTTGAGCTTGCAGATCGACTCGAGCCCGAGTCACGCCGTCGAAGTCGCAGAAAGGCAATGCGCGGCT
CCTGTGATGCCCTCGACGTCGGTCTCGATGCCCGCCTGGACGGCGACCGGCCAGCCAGGGACGGACGAGCCGACG
AATCAAGCCAAGAAACGCGCGTTTCCGCACGACGCTGCTGAAGGTACGACCCTCGCTGAATCGCCACCCTCATCG
TGCTTTACGTCGATAAATGTACCTGCCGGCTCGCCGGGGAAGCGGGTTCGCACGGCCATTCAGGTAGATGCATCA
TCTGCAGGAGACTCCGCCATCGTGACCACCGGCTCCGCATCGTCTCTTCCGGCGCCGAGCCCGTCAAACACGACG
CCCCTCTCGGCCCCCACCGTACCGGCCCACGTCTCTGAAGCGGCCTGGGAGGAGCCGGAAACCACCAAAAACAGA
TCCGGCCTCCAGTGGCAGGAGATGGCAGTGGACCTGTATTTTCGAGAATTCGGCCACCAAGACTTCGACCTGCAG
ATAAGGATCACGGACAACGCGCCTCACGCCTCGTCGCTCTTCAACCCATCTCCCTCGCGCAGCATCATGTCGTAC
GCCGAAGTCGCAGCCAGCGGGCCACGGCAATCCTCTCAAGAGGCTGCCGCTCCCCAGCCGCCAGAGATTATCCCC
AACGAGAGCGCATCGACAGCTTCACTCATAGACGTCGACATGCCCAGCGTTCACACCGTCCGCTCCGATTTCCTA
GAACAGGACGTCCAGACGACGACGCAAGCCGAGCGCCGCGACCGCGAAGACGAAGCCCGCAAGACCAACAAGGCT
CGGTCCGCTCGCCCCTCGTCCTCATCCGCCTCGTCGTCGTCGCCCTCGGTGCGCGGAAGGGCAGATGCCTGGCTG
ACCGGCTACTTCGCCGACTTGTCTGATGGGAGCGCCGGGGCCCTTGCCGTCGCGAATCTCGCTGCTGTCGTCGGT
CTTAGCTCCTACCTCGGCTACAAGGCTTGGGGCCTGTATGATCGAGGCGCGCTGGATTGGAAGGCTGCTGGCTTG
GGTGTGGGCATCTTGGCTACTGTTGGCGCTGTCGAGTCTGTTGTCGGCGGTTACTTGTACAAGGGCAAGGCGAAG
AAGGGCTCGTCGTAG
Gene >Ophcf2|00671
ATGCGCGTATGTCTCGCTGACCGCGACACGACCGCCTTGCAGACAGCAAAGGGCGAACTTGAGAGATCAGCGGGG
AAAGACGTCCTGGCCCTAGTCTCCGATGTCAGCAAGCCTGCCTCGTGGGCAGCTCTCAACAAGGATGTGACAGAG
GCATTCGGCGGCGTCGAGCTGCTGGTCTTGAACGCGGGCATGTCTGCCAATGGGGGCTGGGGGGATGAAGAGTAT
TTCCGCAAGGTCGGTTTCCCAGCCGTCGGACAAAGACATCAGCTGTGCTGATCAACAGCGCTACAGACGCTCGAG
ACGAATCTATTCGGAGTCATCTATGGCATCAATGAGTTTCTCCCGGTTGTCAAGGCAGCAGCAAAGTCCAAGCCG
ACGGCCATTGTGATCACCGGGAGCAAGCAGGGCATCACCAACCCGCCCGGAAATCCGGCATACAACGCCTCCAAG
GCAGCCGTCAAGAGCCTCGCGGAGCATCTCAGCTGGGACTTGAGGAATGACAAGACGACAGTCCACCTGCTAGTC
CCCGGCTGGACCTTTACCGGAATCGTGAGTATCTCGCCTCAACACCGTCGTCAAAACATCATCAGCTGATGGGAG
CAAGACGGGCGGTGGCCGAGACAAAAGTAAGCCCCCGGGGGCCTGGACTTCGGAGCAGGTGGCCGATTATCTATA
CCGGAAGATGGGTGAGGACAAGTTTTACGCCATTTGTCCGGACAATGACGTTTCCGAGGATATGGACAAGAGGCG
CATGCTTTGGACCATGGGCGACGTCGTCGAGCAACGGCCTCCGCTCACGAGATGGCGTGAGGAATGGAAGCAGAA
GGCGGAGGATGCCATGGCCAAGATGAAGGTGTAAGCGAGTAACGTCTGTCACTGGAAGACGGGCGGAAGAAAGGC
AACAGATCTCAGGAAAAGGCATCTGCTAGTGAAGAAGGAATTCGATCTCGGTCTCACGTGGCCCGAGAGATGACG
GCAAGACATCTATCATCACGTGATGCGATAGCCTCCTGCGAACAGGCTACAAGCTCCCGTACCGCCACCGCGAAG
CCGACCAGGTCCGTTTGCGGCCGCGAGCCTCTGCAGGCAGTGCTGCTTCCCATGCGAGGCATTGATGAGGTCGAC
AACATGTCCGAGGACGATATCGATATGCTTGGCTCGGACGGCCAGTCGTCTCGCATCGACCGTGACCGCCGGGCC
CCGAGGTTCAGCTGGAGTCCGGCCTACGAGGAGACCTTCTTCCGCAGCCTGTGCGACAGCGTCCAGCTGGGCCTG
CGTGAGAATAGCAGCTTCAAGACTGAGGTCTGGGATCGGGCAGCCATTGCGCTGCAGGAGATTCACGGCACGTAT
CCAGCCAAGAGCCACCTCATCAATAAGAGCGACAACGCCCGGAAGCGCTTCCGTTTGTGGAGGGGTCTGCGCGAG
GACCCGGACTTTGTGTACGATCCCGTTGAACGGACCGTGACAGCGTCGGAGGATGCCTGGCGGGCCCATATCGAG
GTAAGTCTTCGCCGCTGCTGCCGGCCGCTGCTCCGTTGCTGACCCAATGTCGATCAGAGAGAACCGCTGTCGCGC
GCGCTGCGAGGACGATCGTTTGCTCACGAGGACTTCATGGAGATTCTCTACCCCGATGTCATCGGCTCCGGCGGC
GCCCCGAAGCGCATCATGAAGACCCGACGACGGGTCGATGGCATCATCATCGACGAGGTCGACACGCCCGGCGCA
GGCGTTTTGAGCTTGCAGATCGACTCGAGCCCGAGTCACGCCGTCGAAGTCGCAGAAAGGCAATGCGCGGCTCCT
GTGATGCCCTCGACGTCGGTCTCGATGCCCGCCTGGACGGCGACCGGCCAGCCAGGGACGGACGAGCCGACGAAT
CAAGCCAAGAAACGCGCGTTTCCGCACGACGCTGCTGAAGGTACGACCCTCGCTGAATCGCCACCCTCATCGTGC
TTTACGTCGATAAATGTACCTGCCGGCTCGCCGGGGAAGCGGGTTCGCACGGCCATTCAGGTAGATGCATCATCT
GCAGGAGACTCCGCCATCGTGACCACCGGCTCCGCATCGTCTCTTCCGGCGCCGAGCCCGTCAAACACGACGCCC
CTCTCGGCCCCCACCGTACCGGCCCACGTCTCTGAAGCGGCCTGGGAGGAGCCGGAAACCACCAAAAACAGATCC
GGCCTCCAGTGGCAGGAGATGGCAGTGGACCTGTATTTTCGAGAATTCGGCCACCAAGACTTCGACCTGCAGATA
AGGATCACGGAGTCGATATTGCGGGACGAGCATCGTGCGCTGGTATTTTGCAAGATGCCATGGCGGCTCCGCCAG
TACTGGGTCAGCAAGTGGACGGAAGCGCACCACCGGAGAAGCTGAAGCGAGGCCTGCCTGGACAGCAACGACACA
CGTCGGATAGGGAGTGAAGTTTTTTTTTCGGCCCCGGGCGAAGCGCGTTGACTATATCAAGATACCCGTCGGAAG
GCGTTTGGCATTGCGGAAACAGGCACAGTTGAAATTACGGTGAAGTTGCCATACTAAGGTTGTATCTTAATAGGG
ACATGAGCGCGAAGCAAGTTGACAATCTGCCGCCGAGTGCAGGACGGCTCGATAGGGAGCTGCTCTCTCAGACAG
ACTGATCGAGGATAAGTATGGCATACCTACGGACCCTATCGAGAAGTCCTTGATGAACGGATATGACCAACCTTG
AGGAGGCTGATGCGTGAGCGGACAAGACCGGGCAGATGACGGCTCTAACCATGCCCATGTAGTTCAAGCTAGGTT
CAAGACAGGACGCAACAAGGCATGAGGATAAACAACGGTAAGCGTCAGCATCATCCCGGACGAAGAGAGGCTCGA
CCGACCGCCTCATGGTCGAGACACGGCTCTCCCCTCACAATCTTACCGTTGTTTATGCGTCTGACTTCAGGCCCG
TAAACAAAGAAAACAAACAATCGGCAGTGCGCATGGAAAATTCGCATGTACTAGTCCGTCCGTAGTAACCGTAGC
AGTAATTCGTAAGTAGTCTGTTAAAGGATCGGGCCATCGACGCTGGAGACTCTAGGACGTGGTATTGATGTTTGT
GTCCGTACCAGGCGTACCTCTCAGGTATTCGTAGGTAGGTGTAGGTTAGGTAGGTAGATAGTCACGCCCCCCTCC
ACTTCTCGCAACCCACCTCCTCACTCTCGGCGAAAAAGAAAACCCGCACACAGCCCCCAGTCCAACAAGCTCTGA
GCAACGCGCCTCACGCCTCGTCGCTCTTCAACCCATCTCCCTCGCGCAGCATCAGTGAGTGAACACGCAGGCCTT
CTTCTTCTTCTTGAGGGCGCTCAGCCGCTGACCATGATGATCCCAGTGTCGTACGCCGAAGTCGCAGCCAGCGGG
CCACGGCAATCCTCTCAAGAGGTGAGTTTCCGAGCTTTTTCTCGGCTCGTCAGTCCATCATCTGACGGTAGATGG
TCAAGGCTGCCGCTCCCCAGCCGCCAGAGATTATCCCCAACGAGAGCGCATCGACAGCTTCACTCATAGACGTCG
ACATGCCCAGCGTTCACACCGTCCGCTCCGATTTCCTAGAACAGGACGTCCAGACGACGACGCAAGCCGAGCGCC
GCGACCGCGAAGACGAAGCCCGCAAGACCAACAAGGCTCGGTCCGCTCGCCCCTCGTCCTCATCCGCCTCGTCGT
CGTCGCCCTCGGTGCGCGGAAGGGCAGATGCCTGGCTGACCGGCTACTTCGCCGACTTGTCTGATGGGAGCGCCG
GGGCCCTTGCCGTCGCGAATCTCGCTGCTGTCGTCGGTCTTAGCTCCTACCTCGGCTACAAGGCTTGGGGCCTGT
ATGATCGAGGCGCGCTGGATTGGAAGGCTGCTGGCTTGGGTGTGGGCATCTTGGCTACTGTTGGCGCTGTCGAGT
CTGTTGTCGGCGGTTACTTGTACAAGGGCAAGGCGAAGAAGGGCTCGTCGTAG

© 2022 - Robin Ohm - Utrecht University - The Netherlands

Built with Python Django and Wagtail