Fungal Genomics

at Utrecht University

General Properties

Protein IDOphcf2|00667
Gene name
Locationscaffold_01:2570514..2572083
Strand-
Gene length (bp)1569
Transcript length (bp)1569
Coding sequence length (bp)1569
Protein length (aa) 523

Your browser does not support drawing a protein figure.

PFAM Domains

PFAM Domain ID Short name Long name E-value Start End
PF07690 MFS_1 Major Facilitator Superfamily 6.2E-49 59 465
PF06609 TRI12 Fungal trichothecene efflux pump (TRI12) 8.8E-08 74 237

GO

GO Term Description Terminal node
GO:0022857 transmembrane transporter activity Yes
GO:0055085 transmembrane transport Yes
GO:0051179 localization No
GO:0008150 biological_process No
GO:0006810 transport No
GO:0009987 cellular process No
GO:0003674 molecular_function No
GO:0005215 transporter activity No
GO:0051234 establishment of localization No

SignalP

[Help with interpreting these statistics]
SignalP signal predicted Location
(based on Ymax)
D score
(significance: > 0.45)
No 1 - 70 0.5

Transmembrane Domains

Domain # Start End Length
1 53 75 22
2 90 112 22
3 119 138 19
4 153 170 17
5 177 199 22
6 209 228 19
7 299 321 22
8 336 358 22
9 391 410 19
10 415 437 22
11 458 475 17
12 480 502 22

Transcription Factor Class

(None)

Expression data

Analysis 1: Expression analysis during behavioral modification. Published in: Will et al., G3, 2020

Click here for more information

Sequences

Type of sequenceSequence
Locus Download genbank file of locus
The gene with 5 kb flanks (if sufficient flanking sequence is available). For use in cloning design programs. NOTE: features (genes or exons) that are only partially contained within the sequence are completely excluded.
Protein >Ophcf2|00667
MSTSMAELREKNDKEGRLSSIIPSDGGEAEGQPLAPTQTGPPYSVFTTWQKRAIALGAALAAFFSPLTAMVFLPA
LTAIAGDLGVTISEVNLTITTYMVFQGITPMFIGSLADSGGRRPAYVVCFVIYIAANVGLALAPNYGALLALRCL
QSAGSSSTVALCTAVVADVVTSAERGQYVGFTLVPAVLAPALGPVIGGLLSQFLGWRSIFWFLAISSGATVILII
LFFPETCRHIVGDGSLQPPAMYRSVWQALRSRRKATSTNAKRESSLPEMGKSQFRFRVPNILGSLFMLFEKETAV
LLWASSLVFAGFYSVASAIPVLFTERYGFDEIKVGLMYLPVAVGSIGAACIVGPLINWNFRRHCAKLGVPCDGKR
QQDLSQFPIERARLEVGFPLLAVAGASIIGWGWAIQAQAHVAVPCVISVGLGIGIIGFNNTSNVLLVDMYPGRAG
TATAANNLTRCLVGAGASAAIVPMIDAMGVGWAFTLAGGLLLLCLPAIVLIVSYGQKWRSEQAVKTQGRQGL*
Coding >Ophcf2|00667
ATGAGCACTTCCATGGCTGAGTTGCGCGAAAAGAATGACAAGGAAGGCCGTCTTTCGTCAATCATCCCCAGCGAC
GGCGGCGAAGCAGAAGGCCAGCCTCTTGCGCCGACACAGACCGGACCCCCTTACTCCGTCTTCACCACATGGCAG
AAGCGCGCCATAGCCCTCGGGGCTGCCCTGGCGGCCTTTTTCTCGCCACTGACGGCCATGGTCTTTTTACCGGCC
CTGACAGCCATTGCTGGCGATCTGGGCGTCACCATTTCCGAGGTCAACCTCACCATCACGACCTACATGGTCTTC
CAGGGCATCACACCCATGTTCATCGGCTCGCTGGCAGACAGTGGCGGTCGGCGTCCGGCCTACGTCGTCTGCTTC
GTCATCTACATTGCTGCCAACGTCGGTCTCGCCCTGGCTCCCAACTACGGAGCTCTCCTGGCCCTGCGCTGTCTG
CAGTCGGCCGGGTCGAGCAGCACCGTCGCTCTATGCACGGCCGTCGTGGCCGACGTCGTCACCTCGGCTGAACGA
GGACAGTATGTTGGCTTCACTCTCGTTCCTGCTGTCCTCGCGCCTGCTCTGGGTCCCGTCATCGGGGGTCTCCTC
TCACAATTTCTCGGCTGGAGGTCCATATTCTGGTTCCTGGCCATTTCGTCCGGGGCAACCGTCATTCTCATCATA
CTCTTTTTCCCAGAGACTTGCAGGCACATCGTCGGCGACGGATCTCTCCAGCCGCCGGCTATGTATCGTAGCGTG
TGGCAAGCGTTGAGAAGCCGGCGCAAGGCGACAAGCACCAATGCGAAGCGAGAATCGTCTCTCCCAGAGATGGGG
AAGAGCCAATTCAGGTTCCGGGTGCCCAATATCCTGGGGTCTTTGTTCATGCTCTTCGAGAAGGAGACGGCCGTC
CTCCTCTGGGCAAGCAGCCTTGTTTTTGCGGGCTTTTACTCCGTCGCCTCCGCTATTCCCGTCCTTTTCACCGAG
CGATATGGCTTCGACGAGATCAAGGTCGGCTTGATGTATTTGCCCGTGGCCGTGGGCTCCATCGGCGCCGCCTGC
ATCGTCGGACCCCTGATCAACTGGAATTTCCGGCGACACTGCGCCAAGCTGGGAGTGCCGTGCGACGGCAAGCGG
CAGCAGGACCTCTCACAGTTCCCCATCGAGAGAGCACGTCTGGAAGTTGGATTCCCGCTGCTGGCCGTGGCCGGG
GCGAGCATCATCGGCTGGGGCTGGGCGATACAGGCTCAGGCTCACGTCGCGGTCCCATGCGTCATCAGCGTCGGC
TTGGGCATCGGCATCATCGGCTTCAACAACACGAGCAATGTTCTTCTCGTCGACATGTATCCCGGAAGGGCCGGG
ACTGCGACGGCAGCCAACAACTTGACTCGGTGCCTCGTAGGCGCTGGAGCGAGCGCTGCCATCGTGCCCATGATA
GACGCCATGGGCGTGGGATGGGCCTTTACTCTTGCTGGGGGGCTGCTTCTTTTATGCTTACCTGCTATCGTGCTC
ATCGTCTCATACGGGCAGAAGTGGCGAAGCGAGCAGGCTGTGAAGACCCAGGGGCGGCAAGGATTGTGA
Transcript >Ophcf2|00667
ATGAGCACTTCCATGGCTGAGTTGCGCGAAAAGAATGACAAGGAAGGCCGTCTTTCGTCAATCATCCCCAGCGAC
GGCGGCGAAGCAGAAGGCCAGCCTCTTGCGCCGACACAGACCGGACCCCCTTACTCCGTCTTCACCACATGGCAG
AAGCGCGCCATAGCCCTCGGGGCTGCCCTGGCGGCCTTTTTCTCGCCACTGACGGCCATGGTCTTTTTACCGGCC
CTGACAGCCATTGCTGGCGATCTGGGCGTCACCATTTCCGAGGTCAACCTCACCATCACGACCTACATGGTCTTC
CAGGGCATCACACCCATGTTCATCGGCTCGCTGGCAGACAGTGGCGGTCGGCGTCCGGCCTACGTCGTCTGCTTC
GTCATCTACATTGCTGCCAACGTCGGTCTCGCCCTGGCTCCCAACTACGGAGCTCTCCTGGCCCTGCGCTGTCTG
CAGTCGGCCGGGTCGAGCAGCACCGTCGCTCTATGCACGGCCGTCGTGGCCGACGTCGTCACCTCGGCTGAACGA
GGACAGTATGTTGGCTTCACTCTCGTTCCTGCTGTCCTCGCGCCTGCTCTGGGTCCCGTCATCGGGGGTCTCCTC
TCACAATTTCTCGGCTGGAGGTCCATATTCTGGTTCCTGGCCATTTCGTCCGGGGCAACCGTCATTCTCATCATA
CTCTTTTTCCCAGAGACTTGCAGGCACATCGTCGGCGACGGATCTCTCCAGCCGCCGGCTATGTATCGTAGCGTG
TGGCAAGCGTTGAGAAGCCGGCGCAAGGCGACAAGCACCAATGCGAAGCGAGAATCGTCTCTCCCAGAGATGGGG
AAGAGCCAATTCAGGTTCCGGGTGCCCAATATCCTGGGGTCTTTGTTCATGCTCTTCGAGAAGGAGACGGCCGTC
CTCCTCTGGGCAAGCAGCCTTGTTTTTGCGGGCTTTTACTCCGTCGCCTCCGCTATTCCCGTCCTTTTCACCGAG
CGATATGGCTTCGACGAGATCAAGGTCGGCTTGATGTATTTGCCCGTGGCCGTGGGCTCCATCGGCGCCGCCTGC
ATCGTCGGACCCCTGATCAACTGGAATTTCCGGCGACACTGCGCCAAGCTGGGAGTGCCGTGCGACGGCAAGCGG
CAGCAGGACCTCTCACAGTTCCCCATCGAGAGAGCACGTCTGGAAGTTGGATTCCCGCTGCTGGCCGTGGCCGGG
GCGAGCATCATCGGCTGGGGCTGGGCGATACAGGCTCAGGCTCACGTCGCGGTCCCATGCGTCATCAGCGTCGGC
TTGGGCATCGGCATCATCGGCTTCAACAACACGAGCAATGTTCTTCTCGTCGACATGTATCCCGGAAGGGCCGGG
ACTGCGACGGCAGCCAACAACTTGACTCGGTGCCTCGTAGGCGCTGGAGCGAGCGCTGCCATCGTGCCCATGATA
GACGCCATGGGCGTGGGATGGGCCTTTACTCTTGCTGGGGGGCTGCTTCTTTTATGCTTACCTGCTATCGTGCTC
ATCGTCTCATACGGGCAGAAGTGGCGAAGCGAGCAGGCTGTGAAGACCCAGGGGCGGCAAGGATTGTGA
Gene >Ophcf2|00667
ATGAGCACTTCCATGGCTGAGTTGCGCGAAAAGAATGACAAGGAAGGCCGTCTTTCGTCAATCATCCCCAGCGAC
GGCGGCGAAGCAGAAGGCCAGCCTCTTGCGCCGACACAGACCGGACCCCCTTACTCCGTCTTCACCACATGGCAG
AAGCGCGCCATAGCCCTCGGGGCTGCCCTGGCGGCCTTTTTCTCGCCACTGACGGCCATGGTCTTTTTACCGGCC
CTGACAGCCATTGCTGGCGATCTGGGCGTCACCATTTCCGAGGTCAACCTCACCATCACGACCTACATGGTCTTC
CAGGGCATCACACCCATGTTCATCGGCTCGCTGGCAGACAGTGGCGGTCGGCGTCCGGCCTACGTCGTCTGCTTC
GTCATCTACATTGCTGCCAACGTCGGTCTCGCCCTGGCTCCCAACTACGGAGCTCTCCTGGCCCTGCGCTGTCTG
CAGTCGGCCGGGTCGAGCAGCACCGTCGCTCTATGCACGGCCGTCGTGGCCGACGTCGTCACCTCGGCTGAACGA
GGACAGTATGTTGGCTTCACTCTCGTTCCTGCTGTCCTCGCGCCTGCTCTGGGTCCCGTCATCGGGGGTCTCCTC
TCACAATTTCTCGGCTGGAGGTCCATATTCTGGTTCCTGGCCATTTCGTCCGGGGCAACCGTCATTCTCATCATA
CTCTTTTTCCCAGAGACTTGCAGGCACATCGTCGGCGACGGATCTCTCCAGCCGCCGGCTATGTATCGTAGCGTG
TGGCAAGCGTTGAGAAGCCGGCGCAAGGCGACAAGCACCAATGCGAAGCGAGAATCGTCTCTCCCAGAGATGGGG
AAGAGCCAATTCAGGTTCCGGGTGCCCAATATCCTGGGGTCTTTGTTCATGCTCTTCGAGAAGGAGACGGCCGTC
CTCCTCTGGGCAAGCAGCCTTGTTTTTGCGGGCTTTTACTCCGTCGCCTCCGCTATTCCCGTCCTTTTCACCGAG
CGATATGGCTTCGACGAGATCAAGGTCGGCTTGATGTATTTGCCCGTGGCCGTGGGCTCCATCGGCGCCGCCTGC
ATCGTCGGACCCCTGATCAACTGGAATTTCCGGCGACACTGCGCCAAGCTGGGAGTGCCGTGCGACGGCAAGCGG
CAGCAGGACCTCTCACAGTTCCCCATCGAGAGAGCACGTCTGGAAGTTGGATTCCCGCTGCTGGCCGTGGCCGGG
GCGAGCATCATCGGCTGGGGCTGGGCGATACAGGCTCAGGCTCACGTCGCGGTCCCATGCGTCATCAGCGTCGGC
TTGGGCATCGGCATCATCGGCTTCAACAACACGAGCAATGTTCTTCTCGTCGACATGTATCCCGGAAGGGCCGGG
ACTGCGACGGCAGCCAACAACTTGACTCGGTGCCTCGTAGGCGCTGGAGCGAGCGCTGCCATCGTGCCCATGATA
GACGCCATGGGCGTGGGATGGGCCTTTACTCTTGCTGGGGGGCTGCTTCTTTTATGCTTACCTGCTATCGTGCTC
ATCGTCTCATACGGGCAGAAGTGGCGAAGCGAGCAGGCTGTGAAGACCCAGGGGCGGCAAGGATTGTGA

© 2022 - Robin Ohm - Utrecht University - The Netherlands

Built with Python Django and Wagtail