Fungal Genomics

at Utrecht University

General Properties

Protein IDOphcf2|00664
Gene name
Locationscaffold_01:2563622..2565570
Strand-
Gene length (bp)1948
Transcript length (bp)1581
Coding sequence length (bp)1581
Protein length (aa) 527

Your browser does not support drawing a protein figure.

PFAM Domains

PFAM Domain ID Short name Long name E-value Start End
PF07690 MFS_1 Major Facilitator Superfamily 3.8E-25 57 468
PF00083 Sugar_tr Sugar (and other) transporter 5.1E-07 94 195

GO

GO Term Description Terminal node
GO:0022857 transmembrane transporter activity Yes
GO:0055085 transmembrane transport Yes
GO:0016021 integral component of membrane Yes
GO:0005575 cellular_component No
GO:0051179 localization No
GO:0008150 biological_process No
GO:0031224 intrinsic component of membrane No
GO:0006810 transport No
GO:0009987 cellular process No
GO:0003674 molecular_function No
GO:0005215 transporter activity No
GO:0110165 cellular anatomical entity No
GO:0051234 establishment of localization No

SignalP

[Help with interpreting these statistics]
SignalP signal predicted Location
(based on Ymax)
D score
(significance: > 0.45)
No 1 - 15 0.5

Transmembrane Domains

Domain # Start End Length
1 52 74 22
2 89 111 22
3 118 136 18
4 140 157 17
5 178 200 22
6 210 227 17
7 305 327 22
8 347 369 22
9 390 412 22
10 422 444 22
11 451 470 19
12 485 507 22

Transcription Factor Class

(None)

Expression data

Analysis 1: Expression analysis during behavioral modification. Published in: Will et al., G3, 2020

Click here for more information

Sequences

Type of sequenceSequence
Locus Download genbank file of locus
The gene with 5 kb flanks (if sufficient flanking sequence is available). For use in cloning design programs. NOTE: features (genes or exons) that are only partially contained within the sequence are completely excluded.
Protein >Ophcf2|00664
MASQDATAISRQPPGTVRLFSHEPGEDALVLTPTPTDHPDDALSWSMLRKCWNYGLLMALTVAIFACLTIQPIFW
PQMREEMELSLQELNNAQAFLLVGLAIGCILFVPFAKTYGRRPVYLVSLVLFVASTWWSAVMRSAAEVIMASFLM
GLAGAVNETAVQMTIRDMFFVHQRGTANGIYLIAFSAGSFLVVMAAGVQAERLGWRSSYLTMAGCMTGLSLLSVA
GLEETKPPVPLPTLPVVLKEAKPAGELESSFSSPDGSSVTINHGRRRRRWRLYPGWLRLQLVTRTDESLWKTAWQ
PIRTAWFPHVILTSLEYGAGVCWLVVMGAVTSVLFARPPYSFNAAQIGFILAGGPIVGSLLGGLYGGWFSDWAVV
RFARRNGGVLEPEMRLWLMPLPAVLMSGGLAMFGITVDRGMHWFYPSLGSALYTAGFGAVSDITFTLVIDAFPDI
VPLTFVAIAFFRNGISIAGPFSLAPWMEVASIRGIFVYGMAITFAVHLVAVPVAIWGKRIRTRLEPRYRRLAEMA
C*
Coding >Ophcf2|00664
ATGGCGAGCCAAGACGCGACGGCTATTTCCCGCCAGCCGCCAGGAACCGTTCGACTGTTCTCGCACGAGCCTGGA
GAAGATGCATTGGTGCTGACGCCGACGCCGACTGACCATCCGGATGATGCTCTGTCGTGGTCGATGTTGCGCAAG
TGTTGGAACTATGGGCTGTTGATGGCGCTGACGGTGGCCATCTTTGCCTGCTTGACTATCCAGCCAATCTTCTGG
CCCCAGATGCGAGAAGAGATGGAGCTCTCGCTGCAGGAACTCAACAACGCCCAGGCATTTCTCCTCGTTGGCCTC
GCCATCGGCTGCATTCTCTTCGTCCCCTTCGCCAAGACGTACGGCCGGCGTCCCGTCTACTTGGTGTCGCTGGTG
TTGTTCGTCGCCTCGACCTGGTGGTCGGCCGTGATGCGGTCTGCAGCCGAGGTGATTATGGCCAGTTTCCTCATG
GGACTCGCTGGGGCGGTCAACGAAACTGCCGTTCAAATGACTATCCGCGACATGTTCTTCGTCCATCAGCGGGGG
ACGGCCAACGGCATCTACCTCATCGCCTTCTCAGCCGGGAGCTTCCTCGTCGTCATGGCCGCCGGTGTTCAGGCC
GAAAGGCTCGGCTGGCGGTCTTCTTACCTGACCATGGCCGGCTGCATGACGGGACTGAGTCTACTTTCCGTGGCC
GGCCTGGAGGAGACGAAGCCGCCGGTGCCGCTTCCGACTCTTCCCGTCGTCCTCAAGGAAGCCAAGCCCGCTGGC
GAGCTCGAGTCGTCATTTTCAAGCCCCGACGGCAGCTCGGTGACGATTAATCATGGTCGACGACGACGACGATGG
AGGCTCTATCCTGGGTGGCTTCGGCTGCAGCTCGTCACTCGGACGGACGAGTCTCTATGGAAGACGGCCTGGCAG
CCGATCCGAACCGCCTGGTTCCCGCACGTCATTCTCACGTCTCTAGAGTACGGAGCCGGCGTGTGCTGGCTCGTC
GTCATGGGTGCCGTCACCTCGGTCCTCTTCGCGAGGCCACCGTACAGCTTCAACGCGGCCCAGATAGGCTTCATC
CTTGCGGGCGGACCGATCGTGGGCTCGCTGTTGGGGGGTCTCTACGGTGGCTGGTTCTCCGACTGGGCGGTTGTA
CGCTTTGCCAGACGTAACGGGGGCGTGCTGGAGCCGGAGATGAGGCTTTGGCTTATGCCGCTTCCGGCTGTGCTC
ATGTCTGGGGGGTTGGCTATGTTTGGCATCACGGTTGATCGTGGCATGCACTGGTTCTATCCCAGTCTCGGTTCG
GCCCTCTATACCGCCGGATTCGGGGCCGTGTCGGACATAACATTCACCCTCGTCATCGACGCCTTTCCAGACATT
GTGCCCTTGACGTTTGTGGCCATTGCCTTCTTCCGCAACGGCATCAGCATCGCCGGCCCCTTTTCCCTGGCGCCG
TGGATGGAGGTGGCGAGCATCCGCGGCATCTTCGTGTACGGCATGGCCATCACCTTTGCCGTTCATCTCGTGGCC
GTTCCCGTGGCGATTTGGGGCAAACGGATTCGGACGCGGCTGGAGCCTCGGTATCGTCGTCTGGCGGAGATGGCG
TGCTGA
Transcript >Ophcf2|00664
ATGGCGAGCCAAGACGCGACGGCTATTTCCCGCCAGCCGCCAGGAACCGTTCGACTGTTCTCGCACGAGCCTGGA
GAAGATGCATTGGTGCTGACGCCGACGCCGACTGACCATCCGGATGATGCTCTGTCGTGGTCGATGTTGCGCAAG
TGTTGGAACTATGGGCTGTTGATGGCGCTGACGGTGGCCATCTTTGCCTGCTTGACTATCCAGCCAATCTTCTGG
CCCCAGATGCGAGAAGAGATGGAGCTCTCGCTGCAGGAACTCAACAACGCCCAGGCATTTCTCCTCGTTGGCCTC
GCCATCGGCTGCATTCTCTTCGTCCCCTTCGCCAAGACGTACGGCCGGCGTCCCGTCTACTTGGTGTCGCTGGTG
TTGTTCGTCGCCTCGACCTGGTGGTCGGCCGTGATGCGGTCTGCAGCCGAGGTGATTATGGCCAGTTTCCTCATG
GGACTCGCTGGGGCGGTCAACGAAACTGCCGTTCAAATGACTATCCGCGACATGTTCTTCGTCCATCAGCGGGGG
ACGGCCAACGGCATCTACCTCATCGCCTTCTCAGCCGGGAGCTTCCTCGTCGTCATGGCCGCCGGTGTTCAGGCC
GAAAGGCTCGGCTGGCGGTCTTCTTACCTGACCATGGCCGGCTGCATGACGGGACTGAGTCTACTTTCCGTGGCC
GGCCTGGAGGAGACGAAGCCGCCGGTGCCGCTTCCGACTCTTCCCGTCGTCCTCAAGGAAGCCAAGCCCGCTGGC
GAGCTCGAGTCGTCATTTTCAAGCCCCGACGGCAGCTCGGTGACGATTAATCATGGTCGACGACGACGACGATGG
AGGCTCTATCCTGGGTGGCTTCGGCTGCAGCTCGTCACTCGGACGGACGAGTCTCTATGGAAGACGGCCTGGCAG
CCGATCCGAACCGCCTGGTTCCCGCACGTCATTCTCACGTCTCTAGAGTACGGAGCCGGCGTGTGCTGGCTCGTC
GTCATGGGTGCCGTCACCTCGGTCCTCTTCGCGAGGCCACCGTACAGCTTCAACGCGGCCCAGATAGGCTTCATC
CTTGCGGGCGGACCGATCGTGGGCTCGCTGTTGGGGGGTCTCTACGGTGGCTGGTTCTCCGACTGGGCGGTTGTA
CGCTTTGCCAGACGTAACGGGGGCGTGCTGGAGCCGGAGATGAGGCTTTGGCTTATGCCGCTTCCGGCTGTGCTC
ATGTCTGGGGGGTTGGCTATGTTTGGCATCACGGTTGATCGTGGCATGCACTGGTTCTATCCCAGTCTCGGTTCG
GCCCTCTATACCGCCGGATTCGGGGCCGTGTCGGACATAACATTCACCCTCGTCATCGACGCCTTTCCAGACATT
GTGCCCTTGACGTTTGTGGCCATTGCCTTCTTCCGCAACGGCATCAGCATCGCCGGCCCCTTTTCCCTGGCGCCG
TGGATGGAGGTGGCGAGCATCCGCGGCATCTTCGTGTACGGCATGGCCATCACCTTTGCCGTTCATCTCGTGGCC
GTTCCCGTGGCGATTTGGGGCAAACGGATTCGGACGCGGCTGGAGCCTCGGTATCGTCGTCTGGCGGAGATGGCG
TGCTGA
Gene >Ophcf2|00664
ATGGCGAGCCAAGACGCGACGGCTATTTCCCGCCAGCCGCCAGGAACCGTTCGACTGTTCTCGCGTGAGCGGTCA
TGGTCAACCCCCTACGCACCTTTCGGCTGATGCTTGTGTCTTTGACAGACGAGCCTGGAGAAGATGCATTGGTGC
TGACGCCGACGCCGACTGACCATCCGGATGATGCTCTGGTTCGTACAGCCAGCTCGTCCGTGACCGGAGCTGATG
CCTTGGCAGTCGTGGTCGATGTTGCGCAAGTGTTGGAACTATGGGCTGTTGATGGCGCTGACGGTGGCCATCTTT
GCCTGGTCAGTTGAGCCCTTGCAAAGAGACGGCTCGAAGCTGAGGCCTTTGCGGACGCAGCTTGACTATCCAGCC
AATCTTCTGGCCCCAGATGCGAGAAGAGATGGAGCTCTCGCTGCAGGAACTCAACAACGCCCAGGCATTTCTCCT
CGTTGGCCTCGCCATCGGCTGCATTCTCTTCGTCCCCTTCGCCAAGACGTACGGCCGGCGTCCCGTCTACTTGGT
GTCGCTGGTGTTGTTCGTCGCCTCGACCTGGTGGTCGGCCGTGATGCGGTCTGCAGCCGAGGTGATTATGGCCAG
TTTCCTCATGGGACTCGCTGGGGCGGTCAACGAAACTGCCGTTCAAATGACTGTGAGTGATTTTCCTTTGCTTTG
TTTCGAGGGATATCCGGGAGTTGATGAACTGTTAGATCCGCGACATGTTCTTCGTCCATCAGCGGGGGACGGCCA
ACGGCATCTACCTCATCGCCTTCTCAGCCGGGAGCTTCCTCGTCGTCATGGCCGCCGGTGTTCAGGCCGAAAGGC
TCGGCTGGCGGTCTTCTTACCTGACCATGGCCGGCTGCATGACGGGACTGAGTCTACTTTCCGTGGCCGGCCTGG
AGGAGACGAAGCCGCCGGTGCCGCTTCCGACTCTTCCCGTCGTCCTCAAGGAAGCCAAGCCCGCTGGCGAGCTCG
AGTCGTCATTTTCAAGCCCCGACGGCAGCTCGGTGACGATTAATCATGGTCGACGACGACGACGATGGAGGCTCT
ATCCTGGGTGGCTTCGGCTGCAGCTCGTCACTCGGACGGACGAGTCTCTATGGAAGACGGCCTGGCAGCCGATCC
GAACCGCCTGGTTCCCGCACGTCATTCTCACGTCTCTAGAGTACGGAGCCGGCGTGTGCTGGCTCGTCGTCATGG
GTGCCGTCACCTCGGTCCTCTTCGCGAGGCCACCGTACAGCTTCAACGCGGCCCAGATAGGCTTCATCCTTGCGG
GCGGACCGATCGTGGGCTCGCTGTTGGGGGGTCTCTACGGTGGCTGGTTCTCCGACTGGGCGGTTGTACGCTTTG
CCAGACGTAACGGGGGCGTGCTGGAGCCGGAGATGAGGCTTTGGCTTATGCCGCTTCCGGCTGTGCTCATGTCTG
GGGGGTTGGCTATGTTTGGCATCACGGTTGATCGTGTAGGTATTTCCCCCCCCGTCTCGTCTTGAATTTGCTGCT
TCATGACGAGACAGATTTCACTGACGAAAAGAGGTCAACGGTCCAGGGCATGCACTGGTTCTATCCCAGTCTCGG
TTCGGCCCTCTATACCGCCGGATTCGGGGCCGTGTCGGACATAACATTCACCCTCGTCATCGACGCCTTTCCAGA
CGTGAGTCTCATTCGTTTTTCTCGGGACGGAGACGAGACTAACGTACGCATCATTGGCCTTCAGATTGTGCCCTT
GACGTTTGTGGCCATTGCCTTCTTCCGCAACGGCATCAGCATCGCCGGCCCCTTTTCCCTGGCGCCGTGGATGGA
GGTGGCGAGCATCCGCGGCATCTTCGTGTACGGCATGGCCATCACCTTTGCCGTTCATCTCGTGGCCGTTCCCGT
GGCGATTTGGGGCAAACGGATTCGGACGCGGCTGGAGCCTCGGTATCGTCGTCTGGCGGAGATGGCGTGCTGA

© 2022 - Robin Ohm - Utrecht University - The Netherlands

Built with Python Django and Wagtail