Fungal Genomics

at Utrecht University

General Properties

Protein IDOphcf2|00663
Gene name
Locationscaffold_01:2561256..2563385
Strand+
Gene length (bp)2129
Transcript length (bp)1833
Coding sequence length (bp)1833
Protein length (aa) 611

Your browser does not support drawing a protein figure.

PFAM Domains

PFAM Domain ID Short name Long name E-value Start End
PF00854 PTR2 POT family 1.4E-75 157 547

GO

GO Term Description Terminal node
GO:0022857 transmembrane transporter activity Yes
GO:0016020 membrane Yes
GO:0055085 transmembrane transport Yes
GO:0005575 cellular_component No
GO:0051179 localization No
GO:0008150 biological_process No
GO:0006810 transport No
GO:0009987 cellular process No
GO:0003674 molecular_function No
GO:0005215 transporter activity No
GO:0110165 cellular anatomical entity No
GO:0051234 establishment of localization No

SignalP

[Help with interpreting these statistics]
SignalP signal predicted Location
(based on Ymax)
D score
(significance: > 0.45)
No 1 - 18 0.45

Transmembrane Domains

Domain # Start End Length
1 128 150 22
2 157 179 22
3 189 211 22
4 246 268 22
5 272 294 22
6 367 389 22
7 404 424 20
8 437 459 22
9 488 510 22
10 523 542 19
11 552 574 22

Transcription Factor Class

(None)

Expression data

Analysis 1: Expression analysis during behavioral modification. Published in: Will et al., G3, 2020

Expression values

Label Description Expression (RPKM) Confidence interval (low) Confidence interval (high)
Fungus Fungus in pure culture 16.75 8.11 25.39
Alive In ants, during behavior modification 176.53 85.71 267.36
Dead In ants, recently dead 207.24 95.92 318.55

Differential expression

Label1 Label2 Q-value Significant difference
Alive Fungus 0.000238 yes
Alive Dead 0.443181 no
Dead Fungus 0.000238 yes

Sequences

Type of sequenceSequence
Locus Download genbank file of locus
The gene with 5 kb flanks (if sufficient flanking sequence is available). For use in cloning design programs. NOTE: features (genes or exons) that are only partially contained within the sequence are completely excluded.
Protein >Ophcf2|00663
MASAVTIDHDAITPATAHLIDDKPAKDKETIVSQASMAGLASTHSAQDDYQGRPTDQEMSSLRRVSGKIMWSMWT
IAFVELCERFSYYGTSVLYTNFINHPLPPGSRTGAPVHAGDLPGALGMGPKAAQGLTLFNMFFAYLMPLVGAWVA
DARMGRFWTLHLAIGISTIAHVILVVAASPNVLANNKASFGVFIVGLLVLCVGTGFFKANVSPLLAEQNDDVRPR
VEVRPDGERVIVDPAVTNTRIFLYFYFCINVGSLTGQIGMVYVEKYVGFWVAFLIPTALFLLAPFVLGSQKKSYK
LKPPTGSLLSKFFRMFLYVRRRSGLTGFDWSVAKPSNVPVGQRPSWMTYDDAWVDEVRRGLKACKVFLFLPIFFL
SYNQMTGNLTIQAGTMELHGVPNDIIQNLNPISILIIIPVFDHLLYPFLRKTGFAFTPIKRMTTGFIIAALSMVA
SAVMQYYIYQKSPCGWYANKTVTIDGEERQCPPAPINVWAQCLPYIFIGIAEVLANVTSYEYAFSKAPENMKSLV
MSVNLFMSAISAAIGQAFTPLSGDPLLVWNYTVVAVIAFIGGVAFWFCFSHLDSEEDKLNMLKKSDFIGQQKPGL
AKAQEAGEDV*
Coding >Ophcf2|00663
ATGGCGAGCGCCGTCACCATCGACCACGATGCCATCACACCCGCCACCGCCCACCTAATAGACGACAAACCGGCC
AAAGACAAGGAAACGATCGTGTCCCAGGCGTCCATGGCGGGCCTGGCCTCGACGCACAGCGCCCAAGACGACTAC
CAAGGCCGCCCGACCGACCAAGAGATGAGCTCCCTCCGTCGCGTCTCGGGCAAGATCATGTGGAGCATGTGGACG
ATTGCCTTCGTCGAGCTGTGCGAGCGCTTCTCCTACTACGGCACTTCGGTTCTCTACACCAACTTCATCAACCAT
CCGCTTCCGCCGGGGTCGCGGACGGGAGCCCCCGTCCATGCGGGGGATTTGCCCGGCGCGTTGGGGATGGGTCCC
AAGGCGGCGCAGGGGCTGACGCTGTTTAACATGTTTTTCGCCTATCTGATGCCGCTGGTTGGAGCCTGGGTCGCC
GACGCTCGAATGGGCCGCTTCTGGACCCTCCACCTCGCAATCGGCATCTCGACCATCGCCCACGTCATCCTCGTC
GTCGCCGCCTCCCCCAACGTCCTGGCCAACAACAAGGCCTCCTTCGGCGTCTTCATCGTCGGACTGCTCGTCCTC
TGCGTCGGAACCGGCTTCTTCAAAGCAAACGTCTCGCCCTTGCTGGCCGAGCAGAACGACGACGTCCGACCGCGG
GTGGAAGTCCGTCCCGATGGCGAGCGCGTCATCGTCGACCCGGCCGTTACCAATACTCGCATCTTCCTCTACTTT
TACTTCTGCATCAATGTCGGCTCCTTGACCGGCCAGATTGGCATGGTTTACGTCGAGAAATACGTCGGCTTCTGG
GTCGCCTTCTTGATACCCACCGCCCTCTTCCTGCTGGCGCCCTTCGTCCTGGGCTCGCAGAAGAAGAGCTACAAG
CTGAAGCCGCCGACGGGCTCGCTGCTGTCCAAGTTCTTCCGCATGTTCCTCTACGTCCGGCGCCGATCCGGACTC
ACCGGCTTCGACTGGAGCGTCGCCAAGCCCTCCAACGTCCCCGTCGGTCAGAGACCCTCGTGGATGACCTACGAC
GATGCCTGGGTAGACGAGGTTCGCCGCGGGCTCAAGGCCTGCAAGGTCTTCCTCTTCCTGCCCATCTTCTTCCTC
TCCTACAACCAGATGACGGGCAATCTCACCATCCAGGCCGGAACCATGGAGTTGCACGGCGTGCCCAACGACATC
ATACAGAACCTCAACCCCATCTCCATCCTCATCATCATCCCCGTCTTCGATCACCTCCTCTACCCCTTCCTGCGC
AAGACGGGATTCGCCTTCACCCCGATCAAGCGCATGACGACGGGCTTCATCATCGCCGCCCTCTCCATGGTCGCC
TCGGCCGTCATGCAGTACTATATATACCAAAAGAGCCCTTGCGGCTGGTACGCCAACAAGACCGTCACCATCGAT
GGCGAGGAGAGGCAATGTCCACCGGCGCCCATCAACGTCTGGGCCCAGTGTCTGCCCTACATCTTCATCGGCATC
GCCGAGGTCTTGGCCAACGTCACCTCGTACGAGTATGCCTTCTCCAAGGCGCCCGAGAACATGAAGTCTCTCGTC
ATGAGCGTCAACCTCTTCATGAGCGCCATCTCCGCCGCCATCGGCCAGGCCTTTACCCCCTTATCTGGCGATCCC
CTCCTGGTCTGGAACTACACCGTCGTGGCCGTCATTGCCTTCATCGGTGGCGTCGCCTTTTGGTTCTGCTTCAGT
CACCTCGACTCTGAGGAGGACAAGCTCAATATGCTTAAAAAGTCCGACTTCATCGGCCAACAGAAACCTGGCCTG
GCCAAGGCTCAGGAAGCGGGCGAAGACGTATGA
Transcript >Ophcf2|00663
ATGGCGAGCGCCGTCACCATCGACCACGATGCCATCACACCCGCCACCGCCCACCTAATAGACGACAAACCGGCC
AAAGACAAGGAAACGATCGTGTCCCAGGCGTCCATGGCGGGCCTGGCCTCGACGCACAGCGCCCAAGACGACTAC
CAAGGCCGCCCGACCGACCAAGAGATGAGCTCCCTCCGTCGCGTCTCGGGCAAGATCATGTGGAGCATGTGGACG
ATTGCCTTCGTCGAGCTGTGCGAGCGCTTCTCCTACTACGGCACTTCGGTTCTCTACACCAACTTCATCAACCAT
CCGCTTCCGCCGGGGTCGCGGACGGGAGCCCCCGTCCATGCGGGGGATTTGCCCGGCGCGTTGGGGATGGGTCCC
AAGGCGGCGCAGGGGCTGACGCTGTTTAACATGTTTTTCGCCTATCTGATGCCGCTGGTTGGAGCCTGGGTCGCC
GACGCTCGAATGGGCCGCTTCTGGACCCTCCACCTCGCAATCGGCATCTCGACCATCGCCCACGTCATCCTCGTC
GTCGCCGCCTCCCCCAACGTCCTGGCCAACAACAAGGCCTCCTTCGGCGTCTTCATCGTCGGACTGCTCGTCCTC
TGCGTCGGAACCGGCTTCTTCAAAGCAAACGTCTCGCCCTTGCTGGCCGAGCAGAACGACGACGTCCGACCGCGG
GTGGAAGTCCGTCCCGATGGCGAGCGCGTCATCGTCGACCCGGCCGTTACCAATACTCGCATCTTCCTCTACTTT
TACTTCTGCATCAATGTCGGCTCCTTGACCGGCCAGATTGGCATGGTTTACGTCGAGAAATACGTCGGCTTCTGG
GTCGCCTTCTTGATACCCACCGCCCTCTTCCTGCTGGCGCCCTTCGTCCTGGGCTCGCAGAAGAAGAGCTACAAG
CTGAAGCCGCCGACGGGCTCGCTGCTGTCCAAGTTCTTCCGCATGTTCCTCTACGTCCGGCGCCGATCCGGACTC
ACCGGCTTCGACTGGAGCGTCGCCAAGCCCTCCAACGTCCCCGTCGGTCAGAGACCCTCGTGGATGACCTACGAC
GATGCCTGGGTAGACGAGGTTCGCCGCGGGCTCAAGGCCTGCAAGGTCTTCCTCTTCCTGCCCATCTTCTTCCTC
TCCTACAACCAGATGACGGGCAATCTCACCATCCAGGCCGGAACCATGGAGTTGCACGGCGTGCCCAACGACATC
ATACAGAACCTCAACCCCATCTCCATCCTCATCATCATCCCCGTCTTCGATCACCTCCTCTACCCCTTCCTGCGC
AAGACGGGATTCGCCTTCACCCCGATCAAGCGCATGACGACGGGCTTCATCATCGCCGCCCTCTCCATGGTCGCC
TCGGCCGTCATGCAGTACTATATATACCAAAAGAGCCCTTGCGGCTGGTACGCCAACAAGACCGTCACCATCGAT
GGCGAGGAGAGGCAATGTCCACCGGCGCCCATCAACGTCTGGGCCCAGTGTCTGCCCTACATCTTCATCGGCATC
GCCGAGGTCTTGGCCAACGTCACCTCGTACGAGTATGCCTTCTCCAAGGCGCCCGAGAACATGAAGTCTCTCGTC
ATGAGCGTCAACCTCTTCATGAGCGCCATCTCCGCCGCCATCGGCCAGGCCTTTACCCCCTTATCTGGCGATCCC
CTCCTGGTCTGGAACTACACCGTCGTGGCCGTCATTGCCTTCATCGGTGGCGTCGCCTTTTGGTTCTGCTTCAGT
CACCTCGACTCTGAGGAGGACAAGCTCAATATGCTTAAAAAGTCCGACTTCATCGGCCAACAGAAACCTGGCCTG
GCCAAGGCTCAGGAAGCGGGCGAAGACGTATGA
Gene >Ophcf2|00663
ATGGCGAGCGCCGTCACCATCGACCACGATGCCATCACACCCGCCACCGCCCACCTAATAGACGACAAACCGGCC
AAAGACAAGGAAACGATCGTGTCCCAGGCGTCCATGGCGGGCCTGGCCTCGACGCACAGCGCCCAAGACGACTAC
CAAGGCCGCCCGACCGACCAAGAGATGAGCTCCCTCCGTCGCGTCTCGGGCAAGATCATGTGGAGCATGTGGACG
ATTGCCTTCGTCGAGCTGTGCGAGCGCTTCTCCTACTACGGCACTTCGGTTCTCTACACCAACTTCATCAACCAT
CCGCTTCCGCCGGGGTCGCGGACGGGAGCCCCCGTCCATGCGGGGGATTTGCCCGGCGCGTTGGGGATGGGTCCC
AAGGCGGCGCAGGGGCTGACGCTGTTTAACATGTTTTTCGCCTATCTGATGCCGCTGGTTGGGTGAGTTTGCTTC
AGGGTTGTTTTGTCGTTGTATGGAGATGGATGACTTGTTTGTTTGTTGTTGTTGTTGTTGTTGTTGTTGTTGTTG
GCGTTGTTGGTGTTGTTGTCGCTGTTGTCGCTGTTGTCGTTGTTAGTGTTGTTGTCGCTGTTGTTGTTGTTGGTG
TTGTTGTCGTTGGTGTTGTTGTCGTTGTCGTTGCTGTTGCTGTTGTCGCCGCCGCTGTTGCCATTGCCATTGCTC
TCCCCCTTCTCAACCCCGTCAACAAACCACTCCCATCGCTAACCTCTTCTTCCCCCAGAGCCTGGGTCGCCGACG
CTCGAATGGGCCGCTTCTGGACCCTCCACCTCGCAATCGGCATCTCGACCATCGCCCACGTCATCCTCGTCGTCG
CCGCCTCCCCCAACGTCCTGGCCAACAACAAGGCCTCCTTCGGCGTCTTCATCGTCGGACTGCTCGTCCTCTGCG
TCGGAACCGGCTTCTTCAAAGCAAACGTCTCGCCCTTGCTGGCCGAGCAGAACGACGACGTCCGACCGCGGGTGG
AAGTCCGTCCCGATGGCGAGCGCGTCATCGTCGACCCGGCCGTTACCAATACTCGCATCTTCCTCTACTTTTACT
TCTGCATCAATGTCGGCTCCTTGACCGGCCAGATTGGCATGGTTTACGTCGAGAAATACGTCGGCTTCTGGGTCG
CCTTCTTGATACCCACCGCCCTCTTCCTGCTGGCGCCCTTCGTCCTGGGCTCGCAGAAGAAGAGCTACAAGCTGA
AGCCGCCGACGGGCTCGCTGCTGTCCAAGTTCTTCCGCATGTTCCTCTACGTCCGGCGCCGATCCGGACTCACCG
GCTTCGACTGGAGCGTCGCCAAGCCCTCCAACGTCCCCGTCGGTCAGAGACCCTCGTGGATGACCTACGACGATG
CCTGGGTAGACGAGGTTCGCCGCGGGCTCAAGGCCTGCAAGGTCTTCCTCTTCCTGCCCATCTTCTTCCTCTCCT
ACAACCAGATGACGGGCAATCTCACCATCCAGGCCGGAACCATGGAGTTGCACGGCGTGCCCAACGACATCATAC
AGAACCTCAACCCCATCTCCATCCTCATCATCATCCCCGTCTTCGATCACCTCCTCTACCCCTTCCTGCGCAAGA
CGGGATTCGCCTTCACCCCGATCAAGCGCATGACGACGGGCTTCATCATCGCCGCCCTCTCCATGGTCGCCTCGG
CCGTCATGCAGTACTATATATACCAAAAGAGCCCTTGCGGCTGGTACGCCAACAAGACCGTCACCATCGATGGCG
AGGAGAGGCAATGTCCACCGGCGCCCATCAACGTCTGGGCCCAGTGTCTGCCCTACATCTTCATCGGCATCGCCG
AGGTCTTGGCCAACGTCACCTCGTACGAGTATGCCTTCTCCAAGGCGCCCGAGAACATGAAGTCTCTCGTCATGA
GCGTCAACCTCTTCATGAGCGCCATCTCCGCCGCCATCGGCCAGGCCTTTACCCCCTTATCTGGCGATCCCCTCC
TGGTCTGGAACTACACCGTCGTGGCCGTCATTGCCTTCATCGGTGGCGTCGCCTTTTGGTTCTGCTTCAGTCACC
TCGACTCTGAGGAGGACAAGCTCAATATGCTTAAAAAGTCCGACTTCATCGGCCAACAGAAACCTGGCCTGGCCA
AGGCTCAGGAAGCGGGCGAAGACGTATGA

© 2022 - Robin Ohm - Utrecht University - The Netherlands

Built with Python Django and Wagtail