Fungal Genomics

at Utrecht University

General Properties

Protein IDOphcf2|00663
Gene name
Locationscaffold_01:2561256..2563385
Strand+
Gene length (bp)2129
Transcript length (bp)1833
Coding sequence length (bp)1833
Protein length (aa) 611

Your browser does not support drawing a protein figure.

PFAM Domains

PFAM Domain ID Short name Long name E-value Start End
PF00854 PTR2 POT family 1.4E-75 157 547

GO

GO Term Description Terminal node
GO:0022857 transmembrane transporter activity Yes
GO:0016020 membrane Yes
GO:0055085 transmembrane transport Yes
GO:0005575 cellular_component No
GO:0051179 localization No
GO:0008150 biological_process No
GO:0006810 transport No
GO:0009987 cellular process No
GO:0003674 molecular_function No
GO:0005215 transporter activity No
GO:0110165 cellular anatomical entity No
GO:0051234 establishment of localization No

SignalP

[Help with interpreting these statistics]
SignalP signal predicted Location
(based on Ymax)
D score
(significance: > 0.45)
No 1 - 18 0.45

Transmembrane Domains

Domain # Start End Length
1 128 150 22
2 157 179 22
3 189 211 22
4 246 268 22
5 272 294 22
6 367 389 22
7 404 424 20
8 437 459 22
9 488 510 22
10 523 542 19
11 552 574 22

Transcription Factor Class

(None)

Expression data

Analysis 1: Expression analysis during behavioral modification. Published in: Will et al., G3, 2020

Click here for more information

Sequences

Type of sequenceSequence
Locus Download genbank file of locus
The gene with 5 kb flanks (if sufficient flanking sequence is available). For use in cloning design programs. NOTE: features (genes or exons) that are only partially contained within the sequence are completely excluded.
Protein >Ophcf2|00663
MASAVTIDHDAITPATAHLIDDKPAKDKETIVSQASMAGLASTHSAQDDYQGRPTDQEMSSLRRVSGKIMWSMWT
IAFVELCERFSYYGTSVLYTNFINHPLPPGSRTGAPVHAGDLPGALGMGPKAAQGLTLFNMFFAYLMPLVGAWVA
DARMGRFWTLHLAIGISTIAHVILVVAASPNVLANNKASFGVFIVGLLVLCVGTGFFKANVSPLLAEQNDDVRPR
VEVRPDGERVIVDPAVTNTRIFLYFYFCINVGSLTGQIGMVYVEKYVGFWVAFLIPTALFLLAPFVLGSQKKSYK
LKPPTGSLLSKFFRMFLYVRRRSGLTGFDWSVAKPSNVPVGQRPSWMTYDDAWVDEVRRGLKACKVFLFLPIFFL
SYNQMTGNLTIQAGTMELHGVPNDIIQNLNPISILIIIPVFDHLLYPFLRKTGFAFTPIKRMTTGFIIAALSMVA
SAVMQYYIYQKSPCGWYANKTVTIDGEERQCPPAPINVWAQCLPYIFIGIAEVLANVTSYEYAFSKAPENMKSLV
MSVNLFMSAISAAIGQAFTPLSGDPLLVWNYTVVAVIAFIGGVAFWFCFSHLDSEEDKLNMLKKSDFIGQQKPGL
AKAQEAGEDV*
Coding >Ophcf2|00663
ATGGCGAGCGCCGTCACCATCGACCACGATGCCATCACACCCGCCACCGCCCACCTAATAGACGACAAACCGGCC
AAAGACAAGGAAACGATCGTGTCCCAGGCGTCCATGGCGGGCCTGGCCTCGACGCACAGCGCCCAAGACGACTAC
CAAGGCCGCCCGACCGACCAAGAGATGAGCTCCCTCCGTCGCGTCTCGGGCAAGATCATGTGGAGCATGTGGACG
ATTGCCTTCGTCGAGCTGTGCGAGCGCTTCTCCTACTACGGCACTTCGGTTCTCTACACCAACTTCATCAACCAT
CCGCTTCCGCCGGGGTCGCGGACGGGAGCCCCCGTCCATGCGGGGGATTTGCCCGGCGCGTTGGGGATGGGTCCC
AAGGCGGCGCAGGGGCTGACGCTGTTTAACATGTTTTTCGCCTATCTGATGCCGCTGGTTGGAGCCTGGGTCGCC
GACGCTCGAATGGGCCGCTTCTGGACCCTCCACCTCGCAATCGGCATCTCGACCATCGCCCACGTCATCCTCGTC
GTCGCCGCCTCCCCCAACGTCCTGGCCAACAACAAGGCCTCCTTCGGCGTCTTCATCGTCGGACTGCTCGTCCTC
TGCGTCGGAACCGGCTTCTTCAAAGCAAACGTCTCGCCCTTGCTGGCCGAGCAGAACGACGACGTCCGACCGCGG
GTGGAAGTCCGTCCCGATGGCGAGCGCGTCATCGTCGACCCGGCCGTTACCAATACTCGCATCTTCCTCTACTTT
TACTTCTGCATCAATGTCGGCTCCTTGACCGGCCAGATTGGCATGGTTTACGTCGAGAAATACGTCGGCTTCTGG
GTCGCCTTCTTGATACCCACCGCCCTCTTCCTGCTGGCGCCCTTCGTCCTGGGCTCGCAGAAGAAGAGCTACAAG
CTGAAGCCGCCGACGGGCTCGCTGCTGTCCAAGTTCTTCCGCATGTTCCTCTACGTCCGGCGCCGATCCGGACTC
ACCGGCTTCGACTGGAGCGTCGCCAAGCCCTCCAACGTCCCCGTCGGTCAGAGACCCTCGTGGATGACCTACGAC
GATGCCTGGGTAGACGAGGTTCGCCGCGGGCTCAAGGCCTGCAAGGTCTTCCTCTTCCTGCCCATCTTCTTCCTC
TCCTACAACCAGATGACGGGCAATCTCACCATCCAGGCCGGAACCATGGAGTTGCACGGCGTGCCCAACGACATC
ATACAGAACCTCAACCCCATCTCCATCCTCATCATCATCCCCGTCTTCGATCACCTCCTCTACCCCTTCCTGCGC
AAGACGGGATTCGCCTTCACCCCGATCAAGCGCATGACGACGGGCTTCATCATCGCCGCCCTCTCCATGGTCGCC
TCGGCCGTCATGCAGTACTATATATACCAAAAGAGCCCTTGCGGCTGGTACGCCAACAAGACCGTCACCATCGAT
GGCGAGGAGAGGCAATGTCCACCGGCGCCCATCAACGTCTGGGCCCAGTGTCTGCCCTACATCTTCATCGGCATC
GCCGAGGTCTTGGCCAACGTCACCTCGTACGAGTATGCCTTCTCCAAGGCGCCCGAGAACATGAAGTCTCTCGTC
ATGAGCGTCAACCTCTTCATGAGCGCCATCTCCGCCGCCATCGGCCAGGCCTTTACCCCCTTATCTGGCGATCCC
CTCCTGGTCTGGAACTACACCGTCGTGGCCGTCATTGCCTTCATCGGTGGCGTCGCCTTTTGGTTCTGCTTCAGT
CACCTCGACTCTGAGGAGGACAAGCTCAATATGCTTAAAAAGTCCGACTTCATCGGCCAACAGAAACCTGGCCTG
GCCAAGGCTCAGGAAGCGGGCGAAGACGTATGA
Transcript >Ophcf2|00663
ATGGCGAGCGCCGTCACCATCGACCACGATGCCATCACACCCGCCACCGCCCACCTAATAGACGACAAACCGGCC
AAAGACAAGGAAACGATCGTGTCCCAGGCGTCCATGGCGGGCCTGGCCTCGACGCACAGCGCCCAAGACGACTAC
CAAGGCCGCCCGACCGACCAAGAGATGAGCTCCCTCCGTCGCGTCTCGGGCAAGATCATGTGGAGCATGTGGACG
ATTGCCTTCGTCGAGCTGTGCGAGCGCTTCTCCTACTACGGCACTTCGGTTCTCTACACCAACTTCATCAACCAT
CCGCTTCCGCCGGGGTCGCGGACGGGAGCCCCCGTCCATGCGGGGGATTTGCCCGGCGCGTTGGGGATGGGTCCC
AAGGCGGCGCAGGGGCTGACGCTGTTTAACATGTTTTTCGCCTATCTGATGCCGCTGGTTGGAGCCTGGGTCGCC
GACGCTCGAATGGGCCGCTTCTGGACCCTCCACCTCGCAATCGGCATCTCGACCATCGCCCACGTCATCCTCGTC
GTCGCCGCCTCCCCCAACGTCCTGGCCAACAACAAGGCCTCCTTCGGCGTCTTCATCGTCGGACTGCTCGTCCTC
TGCGTCGGAACCGGCTTCTTCAAAGCAAACGTCTCGCCCTTGCTGGCCGAGCAGAACGACGACGTCCGACCGCGG
GTGGAAGTCCGTCCCGATGGCGAGCGCGTCATCGTCGACCCGGCCGTTACCAATACTCGCATCTTCCTCTACTTT
TACTTCTGCATCAATGTCGGCTCCTTGACCGGCCAGATTGGCATGGTTTACGTCGAGAAATACGTCGGCTTCTGG
GTCGCCTTCTTGATACCCACCGCCCTCTTCCTGCTGGCGCCCTTCGTCCTGGGCTCGCAGAAGAAGAGCTACAAG
CTGAAGCCGCCGACGGGCTCGCTGCTGTCCAAGTTCTTCCGCATGTTCCTCTACGTCCGGCGCCGATCCGGACTC
ACCGGCTTCGACTGGAGCGTCGCCAAGCCCTCCAACGTCCCCGTCGGTCAGAGACCCTCGTGGATGACCTACGAC
GATGCCTGGGTAGACGAGGTTCGCCGCGGGCTCAAGGCCTGCAAGGTCTTCCTCTTCCTGCCCATCTTCTTCCTC
TCCTACAACCAGATGACGGGCAATCTCACCATCCAGGCCGGAACCATGGAGTTGCACGGCGTGCCCAACGACATC
ATACAGAACCTCAACCCCATCTCCATCCTCATCATCATCCCCGTCTTCGATCACCTCCTCTACCCCTTCCTGCGC
AAGACGGGATTCGCCTTCACCCCGATCAAGCGCATGACGACGGGCTTCATCATCGCCGCCCTCTCCATGGTCGCC
TCGGCCGTCATGCAGTACTATATATACCAAAAGAGCCCTTGCGGCTGGTACGCCAACAAGACCGTCACCATCGAT
GGCGAGGAGAGGCAATGTCCACCGGCGCCCATCAACGTCTGGGCCCAGTGTCTGCCCTACATCTTCATCGGCATC
GCCGAGGTCTTGGCCAACGTCACCTCGTACGAGTATGCCTTCTCCAAGGCGCCCGAGAACATGAAGTCTCTCGTC
ATGAGCGTCAACCTCTTCATGAGCGCCATCTCCGCCGCCATCGGCCAGGCCTTTACCCCCTTATCTGGCGATCCC
CTCCTGGTCTGGAACTACACCGTCGTGGCCGTCATTGCCTTCATCGGTGGCGTCGCCTTTTGGTTCTGCTTCAGT
CACCTCGACTCTGAGGAGGACAAGCTCAATATGCTTAAAAAGTCCGACTTCATCGGCCAACAGAAACCTGGCCTG
GCCAAGGCTCAGGAAGCGGGCGAAGACGTATGA
Gene >Ophcf2|00663
ATGGCGAGCGCCGTCACCATCGACCACGATGCCATCACACCCGCCACCGCCCACCTAATAGACGACAAACCGGCC
AAAGACAAGGAAACGATCGTGTCCCAGGCGTCCATGGCGGGCCTGGCCTCGACGCACAGCGCCCAAGACGACTAC
CAAGGCCGCCCGACCGACCAAGAGATGAGCTCCCTCCGTCGCGTCTCGGGCAAGATCATGTGGAGCATGTGGACG
ATTGCCTTCGTCGAGCTGTGCGAGCGCTTCTCCTACTACGGCACTTCGGTTCTCTACACCAACTTCATCAACCAT
CCGCTTCCGCCGGGGTCGCGGACGGGAGCCCCCGTCCATGCGGGGGATTTGCCCGGCGCGTTGGGGATGGGTCCC
AAGGCGGCGCAGGGGCTGACGCTGTTTAACATGTTTTTCGCCTATCTGATGCCGCTGGTTGGGTGAGTTTGCTTC
AGGGTTGTTTTGTCGTTGTATGGAGATGGATGACTTGTTTGTTTGTTGTTGTTGTTGTTGTTGTTGTTGTTGTTG
GCGTTGTTGGTGTTGTTGTCGCTGTTGTCGCTGTTGTCGTTGTTAGTGTTGTTGTCGCTGTTGTTGTTGTTGGTG
TTGTTGTCGTTGGTGTTGTTGTCGTTGTCGTTGCTGTTGCTGTTGTCGCCGCCGCTGTTGCCATTGCCATTGCTC
TCCCCCTTCTCAACCCCGTCAACAAACCACTCCCATCGCTAACCTCTTCTTCCCCCAGAGCCTGGGTCGCCGACG
CTCGAATGGGCCGCTTCTGGACCCTCCACCTCGCAATCGGCATCTCGACCATCGCCCACGTCATCCTCGTCGTCG
CCGCCTCCCCCAACGTCCTGGCCAACAACAAGGCCTCCTTCGGCGTCTTCATCGTCGGACTGCTCGTCCTCTGCG
TCGGAACCGGCTTCTTCAAAGCAAACGTCTCGCCCTTGCTGGCCGAGCAGAACGACGACGTCCGACCGCGGGTGG
AAGTCCGTCCCGATGGCGAGCGCGTCATCGTCGACCCGGCCGTTACCAATACTCGCATCTTCCTCTACTTTTACT
TCTGCATCAATGTCGGCTCCTTGACCGGCCAGATTGGCATGGTTTACGTCGAGAAATACGTCGGCTTCTGGGTCG
CCTTCTTGATACCCACCGCCCTCTTCCTGCTGGCGCCCTTCGTCCTGGGCTCGCAGAAGAAGAGCTACAAGCTGA
AGCCGCCGACGGGCTCGCTGCTGTCCAAGTTCTTCCGCATGTTCCTCTACGTCCGGCGCCGATCCGGACTCACCG
GCTTCGACTGGAGCGTCGCCAAGCCCTCCAACGTCCCCGTCGGTCAGAGACCCTCGTGGATGACCTACGACGATG
CCTGGGTAGACGAGGTTCGCCGCGGGCTCAAGGCCTGCAAGGTCTTCCTCTTCCTGCCCATCTTCTTCCTCTCCT
ACAACCAGATGACGGGCAATCTCACCATCCAGGCCGGAACCATGGAGTTGCACGGCGTGCCCAACGACATCATAC
AGAACCTCAACCCCATCTCCATCCTCATCATCATCCCCGTCTTCGATCACCTCCTCTACCCCTTCCTGCGCAAGA
CGGGATTCGCCTTCACCCCGATCAAGCGCATGACGACGGGCTTCATCATCGCCGCCCTCTCCATGGTCGCCTCGG
CCGTCATGCAGTACTATATATACCAAAAGAGCCCTTGCGGCTGGTACGCCAACAAGACCGTCACCATCGATGGCG
AGGAGAGGCAATGTCCACCGGCGCCCATCAACGTCTGGGCCCAGTGTCTGCCCTACATCTTCATCGGCATCGCCG
AGGTCTTGGCCAACGTCACCTCGTACGAGTATGCCTTCTCCAAGGCGCCCGAGAACATGAAGTCTCTCGTCATGA
GCGTCAACCTCTTCATGAGCGCCATCTCCGCCGCCATCGGCCAGGCCTTTACCCCCTTATCTGGCGATCCCCTCC
TGGTCTGGAACTACACCGTCGTGGCCGTCATTGCCTTCATCGGTGGCGTCGCCTTTTGGTTCTGCTTCAGTCACC
TCGACTCTGAGGAGGACAAGCTCAATATGCTTAAAAAGTCCGACTTCATCGGCCAACAGAAACCTGGCCTGGCCA
AGGCTCAGGAAGCGGGCGAAGACGTATGA

© 2022 - Robin Ohm - Utrecht University - The Netherlands

Built with Python Django and Wagtail