Fungal Genomics

at Utrecht University

General Properties

Protein IDOphcf2|00657
Gene name
Locationscaffold_01:2548276..2550842
Strand-
Gene length (bp)2566
Transcript length (bp)2319
Coding sequence length (bp)2319
Protein length (aa) 773

Your browser does not support drawing a protein figure.

PFAM Domains

PFAM Domain ID Short name Long name E-value Start End
PF00916 Sulfate_transp Sulfate permease family 3.3E-109 76 464
PF01740 STAS STAS domain 2.0E-06 558 655

GO

GO Term Description Terminal node
GO:0015116 sulfate transmembrane transporter activity Yes
GO:0008272 sulfate transport Yes
GO:0016021 integral component of membrane Yes
GO:0005575 cellular_component No
GO:0051234 establishment of localization No
GO:0110165 cellular anatomical entity No
GO:0006810 transport No
GO:0022857 transmembrane transporter activity No
GO:0015318 inorganic molecular entity transmembrane transporter activity No
GO:1901682 sulfur compound transmembrane transporter activity No
GO:0031224 intrinsic component of membrane No
GO:0005215 transporter activity No
GO:0015698 inorganic anion transport No
GO:0008509 anion transmembrane transporter activity No
GO:0003674 molecular_function No
GO:0006820 anion transport No
GO:0015103 inorganic anion transmembrane transporter activity No
GO:0072348 sulfur compound transport No
GO:0015075 ion transmembrane transporter activity No
GO:0006811 ion transport No
GO:0008150 biological_process No
GO:0051179 localization No

SignalP

[Help with interpreting these statistics]
SignalP signal predicted Location
(based on Ymax)
D score
(significance: > 0.45)
No 1 - 21 0.45

Transmembrane Domains

Domain # Start End Length
1 73 92 19
2 105 124 19
3 154 176 22
4 181 203 22
5 240 257 17
6 270 292 22
7 365 387 22
8 403 425 22
9 430 452 22
10 459 491 32

Transcription Factor Class

(None)

Expression data

Analysis 1: Expression analysis during behavioral modification. Published in: Will et al., G3, 2020

Expression values

Label Description Expression (RPKM) Confidence interval (low) Confidence interval (high)
Fungus Fungus in pure culture 61.30 34.65 87.95
Alive In ants, during behavior modification 40.53 23.16 57.89
Dead In ants, recently dead 48.19 27.30 69.08

Differential expression

Label1 Label2 Q-value Significant difference
Alive Fungus 0.022639 yes
Alive Dead 0.307721 no
Dead Fungus 0.215315 no

Sequences

Type of sequenceSequence
Locus Download genbank file of locus
The gene with 5 kb flanks (if sufficient flanking sequence is available). For use in cloning design programs. NOTE: features (genes or exons) that are only partially contained within the sequence are completely excluded.
Protein >Ophcf2|00657
MSSSVKGRLAEAMGLAPVAREHRVPPLSNADSFVDRDPSVSEFLAELVPSNRDVARYLASLFPFVDWIYKYNVGW
FIGDLIAGTTVGAVVVPQGMAYAQLAQLPVEYGLYSSFMGVVVYWAFATSKDITIGPVAVMSQVTGNVVLRARDS
LPGVEGHVVASALAVVTGAIIVALGLARLGWLVELIPLPAICAFMTGSAVNIASGQVPKLMGIDGVNARDATYRV
IIDTLRRLPTTRLDAAMGLTALAMLYVIRAWCSSMARRKPRLSKVFFFVSTLRTVFVILLYTGISAAVNVSRRDR
PKFSIIKDVPRGFQHAAVPDVDPAIVRTLASELPAAVIVMLIEHISISKSFGRINNYVIDPSQELVAIGVSNLLG
PFLGAYPATGSFSRTAIKSKAGVRTPFAGVITAMVVLLALYALTGVFYFIPNATLAAVIIHAVIDVVTPPAVVVQ
FWRVSPLEAVIFVAGVLVTVFSSIEMGIYVTVGISFAVLIWRLFLSRGRMLGLVRIRTARAVPSVGGKTDDGEGQ
AVAEESDQSLRTGFLPLGHEDGSNPSVVLQSPHPGIFIYSFAQGFNYPNASRSLGQLTETVFRETRRTDISSLGP
LKDRPWNDTSPRTLKVDEADDRPTLKAIILDFSSVNNIDVTATQALMDVRNQLDAYAAPDRVDWHFAHIRSRWTK
RSLAAAGFGFRTPRAEPQWKTIFSIADLVGAGGSAQAERFRLLATRDPEAEAEAEAEAEAEAGSGARLVAVQGLN
RPLFHLDLQEAVEAALLNAEGE*
Coding >Ophcf2|00657
ATGAGCTCTTCGGTCAAGGGTCGTCTGGCCGAGGCCATGGGCCTAGCGCCCGTCGCCCGTGAACACCGTGTGCCG
CCGCTTTCCAATGCCGACAGCTTCGTCGACCGCGATCCCTCAGTATCCGAGTTTCTCGCCGAATTGGTCCCCTCG
AACCGCGACGTCGCCCGCTACCTTGCTAGCCTATTTCCCTTTGTCGACTGGATCTACAAGTACAATGTGGGCTGG
TTCATCGGTGACCTCATCGCCGGCACCACTGTGGGAGCCGTCGTCGTGCCTCAGGGCATGGCCTACGCACAGCTG
GCCCAGCTCCCGGTCGAATACGGCCTGTACTCGTCTTTTATGGGCGTCGTCGTGTACTGGGCGTTTGCGACCTCC
AAGGACATCACCATCGGCCCCGTCGCTGTCATGTCCCAGGTAACTGGCAACGTCGTCCTTCGCGCCAGAGACTCG
CTGCCCGGTGTCGAGGGTCACGTCGTCGCCTCGGCCCTGGCCGTCGTCACGGGCGCCATCATTGTCGCTCTGGGC
CTCGCCCGTCTCGGCTGGCTCGTCGAACTGATCCCGCTGCCGGCCATCTGCGCCTTCATGACGGGATCCGCCGTC
AACATCGCCAGCGGCCAGGTACCCAAACTCATGGGCATCGATGGCGTCAACGCCCGCGACGCCACCTATCGCGTC
ATCATCGACACCCTGCGGAGACTACCTACGACCCGACTCGACGCCGCCATGGGCCTGACGGCTCTCGCCATGCTC
TATGTAATCCGCGCCTGGTGTTCCAGCATGGCCAGACGCAAGCCTCGCCTGTCCAAGGTCTTCTTCTTCGTCTCG
ACGCTGCGCACCGTCTTCGTAATCCTGTTGTATACGGGCATCAGCGCCGCCGTCAACGTTTCGCGCAGGGACAGG
CCCAAGTTTAGCATCATCAAGGACGTTCCGCGAGGCTTTCAGCACGCCGCTGTGCCCGACGTCGATCCCGCCATC
GTGAGAACGCTGGCATCGGAACTCCCTGCGGCCGTCATCGTCATGCTCATTGAGCACATCTCCATCTCCAAGTCG
TTTGGGCGCATCAATAACTACGTCATCGACCCTTCGCAGGAGCTGGTGGCCATTGGTGTCAGTAATCTCCTGGGG
CCTTTTCTCGGCGCCTACCCGGCTACCGGGTCCTTTTCACGCACGGCCATCAAGTCCAAGGCCGGGGTGCGGACG
CCCTTTGCCGGCGTCATCACGGCCATGGTGGTGCTACTCGCGCTGTATGCGCTGACGGGCGTCTTCTACTTTATC
CCAAACGCCACTCTGGCAGCCGTCATCATACACGCCGTCATTGACGTGGTGACGCCGCCGGCCGTCGTGGTCCAG
TTCTGGCGCGTATCGCCGCTCGAGGCCGTCATCTTCGTAGCCGGCGTGCTGGTGACGGTGTTTAGCAGCATCGAG
ATGGGCATCTACGTGACGGTCGGCATCTCGTTTGCCGTCCTCATCTGGAGACTGTTTCTCAGCCGGGGCCGGATG
CTGGGACTCGTGCGGATCCGCACCGCCAGGGCCGTGCCGAGTGTCGGCGGTAAGACGGACGACGGCGAGGGGCAG
GCGGTGGCGGAAGAATCAGACCAGTCGCTACGCACCGGCTTCCTCCCGCTGGGCCACGAGGACGGGTCGAACCCG
AGCGTGGTGTTGCAGAGCCCGCACCCGGGCATCTTCATCTACAGCTTCGCTCAGGGCTTCAACTACCCAAACGCG
TCGCGTTCCCTGGGCCAGCTCACCGAGACGGTCTTCCGCGAGACGAGACGGACAGACATCAGCTCGCTTGGCCCG
CTCAAGGACCGTCCGTGGAATGACACGTCGCCGCGGACGCTCAAAGTGGACGAGGCCGACGACCGACCGACGCTC
AAGGCCATTATCCTCGACTTTTCTTCGGTAAATAACATTGACGTAACGGCGACACAGGCGCTCATGGATGTGCGA
AACCAACTGGACGCGTATGCTGCGCCGGACCGGGTAGACTGGCACTTTGCCCACATCCGATCTCGCTGGACGAAG
CGCAGCCTGGCGGCGGCGGGCTTCGGCTTCCGGACGCCACGAGCGGAGCCACAGTGGAAGACGATATTCAGCATC
GCCGACCTCGTAGGAGCCGGCGGATCGGCGCAGGCGGAGCGCTTTCGGCTGCTGGCGACGCGGGACCCGGAAGCG
GAGGCGGAGGCGGAGGCGGAGGCGGAGGCGGAGGCGGGCAGCGGCGCACGGCTGGTGGCGGTGCAGGGGCTCAAC
CGACCCCTGTTCCACCTGGACTTGCAAGAGGCGGTTGAGGCAGCGCTGCTGAATGCCGAGGGCGAGTGA
Transcript >Ophcf2|00657
ATGAGCTCTTCGGTCAAGGGTCGTCTGGCCGAGGCCATGGGCCTAGCGCCCGTCGCCCGTGAACACCGTGTGCCG
CCGCTTTCCAATGCCGACAGCTTCGTCGACCGCGATCCCTCAGTATCCGAGTTTCTCGCCGAATTGGTCCCCTCG
AACCGCGACGTCGCCCGCTACCTTGCTAGCCTATTTCCCTTTGTCGACTGGATCTACAAGTACAATGTGGGCTGG
TTCATCGGTGACCTCATCGCCGGCACCACTGTGGGAGCCGTCGTCGTGCCTCAGGGCATGGCCTACGCACAGCTG
GCCCAGCTCCCGGTCGAATACGGCCTGTACTCGTCTTTTATGGGCGTCGTCGTGTACTGGGCGTTTGCGACCTCC
AAGGACATCACCATCGGCCCCGTCGCTGTCATGTCCCAGGTAACTGGCAACGTCGTCCTTCGCGCCAGAGACTCG
CTGCCCGGTGTCGAGGGTCACGTCGTCGCCTCGGCCCTGGCCGTCGTCACGGGCGCCATCATTGTCGCTCTGGGC
CTCGCCCGTCTCGGCTGGCTCGTCGAACTGATCCCGCTGCCGGCCATCTGCGCCTTCATGACGGGATCCGCCGTC
AACATCGCCAGCGGCCAGGTACCCAAACTCATGGGCATCGATGGCGTCAACGCCCGCGACGCCACCTATCGCGTC
ATCATCGACACCCTGCGGAGACTACCTACGACCCGACTCGACGCCGCCATGGGCCTGACGGCTCTCGCCATGCTC
TATGTAATCCGCGCCTGGTGTTCCAGCATGGCCAGACGCAAGCCTCGCCTGTCCAAGGTCTTCTTCTTCGTCTCG
ACGCTGCGCACCGTCTTCGTAATCCTGTTGTATACGGGCATCAGCGCCGCCGTCAACGTTTCGCGCAGGGACAGG
CCCAAGTTTAGCATCATCAAGGACGTTCCGCGAGGCTTTCAGCACGCCGCTGTGCCCGACGTCGATCCCGCCATC
GTGAGAACGCTGGCATCGGAACTCCCTGCGGCCGTCATCGTCATGCTCATTGAGCACATCTCCATCTCCAAGTCG
TTTGGGCGCATCAATAACTACGTCATCGACCCTTCGCAGGAGCTGGTGGCCATTGGTGTCAGTAATCTCCTGGGG
CCTTTTCTCGGCGCCTACCCGGCTACCGGGTCCTTTTCACGCACGGCCATCAAGTCCAAGGCCGGGGTGCGGACG
CCCTTTGCCGGCGTCATCACGGCCATGGTGGTGCTACTCGCGCTGTATGCGCTGACGGGCGTCTTCTACTTTATC
CCAAACGCCACTCTGGCAGCCGTCATCATACACGCCGTCATTGACGTGGTGACGCCGCCGGCCGTCGTGGTCCAG
TTCTGGCGCGTATCGCCGCTCGAGGCCGTCATCTTCGTAGCCGGCGTGCTGGTGACGGTGTTTAGCAGCATCGAG
ATGGGCATCTACGTGACGGTCGGCATCTCGTTTGCCGTCCTCATCTGGAGACTGTTTCTCAGCCGGGGCCGGATG
CTGGGACTCGTGCGGATCCGCACCGCCAGGGCCGTGCCGAGTGTCGGCGGTAAGACGGACGACGGCGAGGGGCAG
GCGGTGGCGGAAGAATCAGACCAGTCGCTACGCACCGGCTTCCTCCCGCTGGGCCACGAGGACGGGTCGAACCCG
AGCGTGGTGTTGCAGAGCCCGCACCCGGGCATCTTCATCTACAGCTTCGCTCAGGGCTTCAACTACCCAAACGCG
TCGCGTTCCCTGGGCCAGCTCACCGAGACGGTCTTCCGCGAGACGAGACGGACAGACATCAGCTCGCTTGGCCCG
CTCAAGGACCGTCCGTGGAATGACACGTCGCCGCGGACGCTCAAAGTGGACGAGGCCGACGACCGACCGACGCTC
AAGGCCATTATCCTCGACTTTTCTTCGGTAAATAACATTGACGTAACGGCGACACAGGCGCTCATGGATGTGCGA
AACCAACTGGACGCGTATGCTGCGCCGGACCGGGTAGACTGGCACTTTGCCCACATCCGATCTCGCTGGACGAAG
CGCAGCCTGGCGGCGGCGGGCTTCGGCTTCCGGACGCCACGAGCGGAGCCACAGTGGAAGACGATATTCAGCATC
GCCGACCTCGTAGGAGCCGGCGGATCGGCGCAGGCGGAGCGCTTTCGGCTGCTGGCGACGCGGGACCCGGAAGCG
GAGGCGGAGGCGGAGGCGGAGGCGGAGGCGGAGGCGGGCAGCGGCGCACGGCTGGTGGCGGTGCAGGGGCTCAAC
CGACCCCTGTTCCACCTGGACTTGCAAGAGGCGGTTGAGGCAGCGCTGCTGAATGCCGAGGGCGAGTGA
Gene >Ophcf2|00657
ATGAGCTCTTCGGTCAAGGGTCGTCTGGCCGAGGCCATGGGCCTAGCGCCCGTCGCCCGTGAACACCGTGTGCCG
CCGCTTTCCAATGCCGACAGCTTCGTCGACCGCGATCCCTCAGTATCCGAGTTTCTCGCCGAATTGGTCCCCTCG
AACCGCGACGTCGCCCGCTACCTTGCTAGCCTATTTCCCTTTGTCGACTGGATCTACAAGTACAATGTGGGCTGG
TTCATCGGTGACCTCATCGCCGGTCAGTCTGTCCCGGCTTTGACTTTTGTCCGCCGCTGACGACATGTTCTACCT
ACATAGGCACCACTGTGGGAGCCGTCGTCGTGCCTCAGGGCATGGCCTACGCACAGCTGGCCCAGCTCCCGGTCG
AATACGGCCTGTACTCGTCTTTTATGGGCGTCGTCGTGTACTGGGCGTTTGCGACCTCCAAGGACATCACCATCG
GCGTCGGCATCCCTCCTCCTCCTCCTCCTCCTCCTCCTCTTTCTCTTCCCCTGTCGTTGCTGACCTGCCGGTGTC
GCAGCCCGTCGCTGTCATGTCCCAGGTAACTGGCAACGTCGTCCTTCGCGCCAGAGACTCGCTGCCCGGTGTCGA
GGGTCACGTCGTCGCCTCGGCCCTGGCCGTCGTCACGGGCGCCATCATTGTCGCTCTGGGCCTCGCCCGTCTCGG
CTGGCTCGTCGAACTGATCCCGCTGCCGGCCATCTGCGCCTTCATGACGGGATCCGCCGTCAACATCGCCAGCGG
CCAGGTACCCAAACTCATGGGCATCGATGGCGTCAACGCCCGCGACGCCACCTATCGCGTCATCATCGACACCCT
GCGGAGACTACCTACGACCCGACTCGACGCCGCCATGGGCCTGACGGCTCTCGCCATGCTCTATGTAATCCGCGC
CTGGTGTTCCAGCATGGCCAGACGCAAGCCTCGCCTGTCCAAGGTCTTCTTCTTCGTCTCGACGCTGCGCACCGT
CTTCGTAATCCTGTTGTATACGGGCATCAGCGCCGCCGTCAACGTTTCGCGCAGGGACAGGCCCAAGTTTAGCAT
CATCAAGGACGTTCCGCGAGGTGAGCAATTGATACGTATGTCAACCGGCTGACACGGTCTCATCGTCTTGTCAGG
CTTTCAGCACGCCGCTGTGCCCGACGTCGATCCCGCCATCGTGAGAACGCTGGCATCGGAACTCCCTGCGGCCGT
CATCGTCATGCTCATTGAGCACATCTCCATCTCCAAGTCGTTTGGGCGCATCAATAACTACGTCATCGACCCTTC
GCAGGAGCTGGTGGCCATTGGTGTCAGTAATCTCCTGGGGCCTTTTCTCGGCGCCTACCCGGCTACCGGGTCCTT
TTCACGCACGGCCATCAAGTCCAAGGCCGGGGTGCGGACGCCCTTTGCCGGCGTCATCACGGCCATGGTGGTGCT
ACTCGCGCTGTATGCGCTGACGGGCGTCTTCTACTTTATCCCAAACGCCACTCTGGCAGCCGTCATCATACACGC
CGTCATTGACGTGGTGACGCCGCCGGCCGTCGTGGTCCAGTTCTGGCGCGTATCGCCGCTCGAGGCCGTCATCTT
CGTAGCCGGCGTGCTGGTGACGGTGTTTAGCAGCATCGAGATGGGCATCTACGTGACGGTCGGCATCTCGTTTGC
CGTCCTCATCTGGAGACTGTTTCTCAGCCGGGGCCGGATGCTGGGACTCGTGCGGATCCGCACCGCCAGGGCCGT
GCCGAGTGTCGGCGGTAAGACGGACGACGGCGAGGGGCAGGCGGTGGCGGAAGAATCAGACCAGTCGCTACGCAC
CGGCTTCCTCCCGCTGGGCCACGAGGACGGGTCGAACCCGAGCGTGGTGTTGCAGAGCCCGCACCCGGGCATCTT
CATCTACAGCTTCGCTCAGGGCTTCAACTACCCAAACGCGTCGCGTTCCCTGGGCCAGCTCACCGAGACGGTCTT
CCGCGAGACGAGACGGACAGACATCAGCTCGCTTGGCCCGCTCAAGGTGCGTCAAGGGTCCGGTGCAGGTCGACT
GGCGACGTAGAGCGTTGACATGGTGCAGGACCGTCCGTGGAATGACACGTCGCCGCGGACGCTCAAAGTGGACGA
GGCCGACGACCGACCGACGCTCAAGGCCATTATCCTCGACTTTTCTTCGGTAAATAACATTGACGTAACGGCGAC
ACAGGCGCTCATGGATGTGCGAAACCAACTGGACGCGTATGCTGCGCCGGACCGGGTAGACTGGCACTTTGCCCA
CATCCGATCTCGCTGGACGAAGCGCAGCCTGGCGGCGGCGGGCTTCGGCTTCCGGACGCCACGAGCGGAGCCACA
GTGGAAGACGATATTCAGCATCGCCGACCTCGTAGGAGCCGGCGGATCGGCGCAGGCGGAGCGCTTTCGGCTGCT
GGCGACGCGGGACCCGGAAGCGGAGGCGGAGGCGGAGGCGGAGGCGGAGGCGGAGGCGGGCAGCGGCGCACGGCT
GGTGGCGGTGCAGGGGCTCAACCGACCCCTGTTCCACCTGGACTTGCAAGAGGCGGTTGAGGCAGCGCTGCTGAA
TGCCGAGGGCGAGTGA

© 2022 - Robin Ohm - Utrecht University - The Netherlands

Built with Python Django and Wagtail