Fungal Genomics

at Utrecht University

General Properties

Protein IDOphcf2|00650
Gene name
Locationscaffold_01:2515458..2518147
Strand-
Gene length (bp)2689
Transcript length (bp)2604
Coding sequence length (bp)2604
Protein length (aa) 868

Your browser does not support drawing a protein figure.

PFAM Domains

PFAM Domain ID Short name Long name E-value Start End
PF03169 OPT OPT oligopeptide transporter protein 1.4E-167 153 824

GO

GO Term Description Terminal node
GO:0035673 oligopeptide transmembrane transporter activity Yes
GO:1904680 peptide transmembrane transporter activity No
GO:0042887 amide transmembrane transporter activity No
GO:0022857 transmembrane transporter activity No
GO:0003674 molecular_function No
GO:0005215 transporter activity No

SignalP

[Help with interpreting these statistics]
SignalP signal predicted Location
(based on Ymax)
D score
(significance: > 0.45)
No 1 - 41 0.45

Transmembrane Domains

Domain # Start End Length
1 159 176 17
2 229 251 22
3 266 288 22
4 335 357 22
5 412 434 22
6 479 501 22
7 547 569 22
8 574 593 19
9 656 675 19
10 696 713 17
11 723 745 22
12 766 788 22
13 803 825 22

Transcription Factor Class

(None)

Expression data

Analysis 1: Expression analysis during behavioral modification. Published in: Will et al., G3, 2020

Expression values

Label Description Expression (RPKM) Confidence interval (low) Confidence interval (high)
Fungus Fungus in pure culture 23.12 12.77 33.46
Alive In ants, during behavior modification 24.85 13.76 35.94
Dead In ants, recently dead 24.82 13.78 35.87

Differential expression

Label1 Label2 Q-value Significant difference
Alive Fungus 0.763722 no
Alive Dead 0.995812 no
Dead Fungus 0.767797 no

Sequences

Type of sequenceSequence
Locus Download genbank file of locus
The gene with 5 kb flanks (if sufficient flanking sequence is available). For use in cloning design programs. NOTE: features (genes or exons) that are only partially contained within the sequence are completely excluded.
Protein >Ophcf2|00650
MASSPSSSSSPDDDDKNRAVANEKSRDSPFAYDEDDDDDVCAGRLRATTEHDLDVTEDDLLEAKELASQYTLQQV
RQVMIRVRRVHEKDPNFPAAVMGKIQAFLDNEAVFARPEKHQHLIQEMKLEAALVSCNSPYAEVRAVVSNRDDVS
TPCSTIRSWSIGLVFAVLLAFVNQLFEIRQPAIRVMANVAQLLAYPLGKAAENWLPDRAVTVWGVRHSLNPGPFS
KKEHMLITIMANVAYNTPYTNYIIWVQFLPQYFDQPYASHFAYQLLIALATNFIGYGIAGVCRRFLVYPSYCVWP
ASLVTIALNSAFHTDVNPPVEGPLRRVWRLSRIRFFYLMFACMFLWFWLPGYVWVGLSKFNWLGWISPANRHLNV
VTGINNGLGVNPFPTWDWNVLLWDSADPLMVPFFSTLNRFVGVFASFWLVLGLWYSNAFNTGYLPINTNRVYDHF
AQLYNITRATDDHGLFNQTKYERYSPPFLGAGNIVIYVFFFGIYTSTLTYAALYHRHQIAMGFKALWRSLRRRQP
PRRHSLDVHSRLMAAYPEVPDWWYLACLVCAMAFGVAAIAAWNTHTSPVVVLYGLALCVVFVIPVGIIKAMTGIE
VTLNVLAEFVGGSWVDGNALAMNYFKSFGYVTCAHAIWFCNDLKLAHYVKIPPRHTFVAQMAATFVSTLVCIGVL
NFQMLSIDDVCTPYAQYKLTCPGVNTFFTASVLWGTVGPDRIFGHRGQYSAALVGFPLGVVIVVFFWVLGRRFPR
WDWVRQIHPVAIMYGGIVWAPYNMSYVWPSVPVAWFSWIYLRSRYLGLWSKYNFVLSAAWSCGIAIAGIIIFFAL
QYTGTDLDWWGNRVVDAGCEGKACTLKTLAPGEYFGPRIGDF*
Coding >Ophcf2|00650
ATGGCCTCCTCTCCCTCCTCGTCCTCCTCTCCGGACGACGACGACAAGAACCGGGCCGTCGCCAACGAAAAGTCA
CGAGACTCGCCCTTTGCCTATGACGAGGACGACGACGACGATGTATGCGCTGGCAGGCTGCGGGCTACGACGGAG
CATGACCTCGACGTCACGGAAGACGACCTCCTCGAAGCAAAGGAGCTGGCTTCGCAGTACACGCTCCAGCAAGTG
CGTCAGGTCATGATCCGGGTGCGGCGCGTACACGAAAAGGATCCCAACTTCCCCGCCGCCGTCATGGGAAAGATC
CAGGCTTTCCTCGACAACGAGGCCGTCTTCGCCCGGCCCGAGAAGCACCAACACCTGATACAGGAGATGAAGCTC
GAGGCCGCCCTCGTAAGCTGCAACAGTCCCTACGCCGAGGTACGGGCCGTCGTCAGCAACCGCGACGATGTCTCA
ACACCTTGCTCGACGATACGTTCGTGGTCCATCGGCCTCGTCTTCGCCGTCCTCCTCGCCTTCGTCAACCAGCTC
TTCGAGATTCGACAGCCCGCCATCCGCGTCATGGCAAACGTCGCCCAGCTGCTCGCCTATCCGCTCGGCAAGGCG
GCCGAGAACTGGCTACCGGACCGGGCGGTGACCGTCTGGGGCGTCCGCCACTCGCTCAACCCGGGTCCCTTCTCC
AAGAAGGAGCACATGCTCATCACCATCATGGCAAACGTGGCCTACAACACGCCCTACACGAACTACATCATCTGG
GTCCAATTCCTGCCCCAGTACTTCGACCAGCCCTACGCCTCCCACTTCGCCTACCAGCTCCTCATCGCCCTCGCC
ACAAACTTCATCGGCTATGGCATCGCCGGAGTCTGCCGCCGCTTCCTCGTCTACCCTTCCTACTGCGTCTGGCCG
GCCTCCCTCGTCACCATCGCCCTCAACTCGGCCTTCCACACCGACGTCAACCCGCCCGTCGAAGGGCCCCTGCGC
CGCGTCTGGCGACTCTCGCGCATCCGCTTCTTCTACCTCATGTTCGCCTGCATGTTCCTCTGGTTCTGGCTGCCC
GGATACGTCTGGGTCGGCCTGTCCAAGTTCAACTGGCTCGGCTGGATATCGCCGGCCAACCGCCACCTCAACGTG
GTGACGGGCATCAACAACGGCCTCGGCGTCAACCCCTTCCCGACCTGGGACTGGAACGTCCTGCTCTGGGACTCG
GCGGACCCTCTCATGGTGCCCTTCTTCAGCACGCTCAACCGCTTCGTCGGCGTCTTCGCCTCCTTCTGGCTCGTC
CTCGGCCTCTGGTACTCCAACGCCTTCAACACGGGCTACCTCCCCATCAACACCAACCGCGTCTACGACCACTTC
GCCCAGCTCTACAACATCACGCGCGCCACGGACGACCACGGCCTCTTCAACCAGACAAAGTACGAGCGGTACTCG
CCACCCTTCCTCGGCGCCGGCAACATCGTCATCTACGTCTTCTTCTTCGGCATCTACACCTCGACCCTGACGTAC
GCCGCCCTCTACCACCGCCATCAGATCGCAATGGGCTTCAAGGCCCTCTGGCGCAGTCTCCGTCGCCGCCAGCCT
CCCCGTCGCCACTCCCTAGACGTCCACAGCCGCCTCATGGCCGCCTACCCCGAGGTGCCCGACTGGTGGTATCTG
GCCTGCCTCGTCTGCGCCATGGCCTTTGGCGTCGCCGCCATAGCCGCCTGGAACACGCACACGTCGCCCGTCGTC
GTCCTCTACGGCCTCGCCCTCTGCGTCGTCTTCGTCATCCCCGTCGGCATCATCAAGGCCATGACGGGCATCGAG
GTGACGCTCAACGTCCTGGCCGAGTTCGTAGGCGGTTCCTGGGTGGACGGGAACGCGCTGGCCATGAACTACTTC
AAGTCCTTCGGCTACGTCACCTGCGCCCACGCCATCTGGTTCTGCAACGACCTCAAGCTGGCTCACTACGTCAAG
ATCCCCCCCAGACACACCTTCGTCGCCCAGATGGCGGCCACCTTCGTCAGCACCCTCGTCTGCATCGGCGTCCTC
AACTTCCAGATGCTCAGCATCGACGACGTCTGCACCCCCTACGCCCAGTACAAGCTGACGTGCCCCGGCGTCAAC
ACCTTCTTCACCGCCTCGGTCCTCTGGGGAACGGTCGGCCCGGACCGCATCTTCGGTCACCGAGGCCAGTACAGC
GCCGCCCTCGTCGGCTTCCCCCTCGGCGTCGTCATCGTCGTCTTCTTCTGGGTCCTCGGCCGCCGTTTCCCCCGC
TGGGATTGGGTCCGCCAGATCCATCCCGTGGCCATCATGTACGGCGGCATCGTCTGGGCCCCCTACAACATGTCG
TACGTCTGGCCGTCGGTGCCCGTCGCCTGGTTCTCGTGGATCTACCTCAGGTCGCGCTATCTCGGCCTGTGGTCC
AAGTACAACTTCGTCCTCTCCGCCGCCTGGTCATGCGGCATCGCCATCGCCGGCATCATCATCTTCTTCGCCCTG
CAATACACGGGCACCGACCTCGACTGGTGGGGCAACCGCGTCGTCGACGCCGGCTGCGAGGGAAAGGCCTGCACC
CTCAAGACTCTCGCCCCCGGCGAGTATTTCGGCCCACGCATCGGTGATTTCTAG
Transcript >Ophcf2|00650
ATGGCCTCCTCTCCCTCCTCGTCCTCCTCTCCGGACGACGACGACAAGAACCGGGCCGTCGCCAACGAAAAGTCA
CGAGACTCGCCCTTTGCCTATGACGAGGACGACGACGACGATGTATGCGCTGGCAGGCTGCGGGCTACGACGGAG
CATGACCTCGACGTCACGGAAGACGACCTCCTCGAAGCAAAGGAGCTGGCTTCGCAGTACACGCTCCAGCAAGTG
CGTCAGGTCATGATCCGGGTGCGGCGCGTACACGAAAAGGATCCCAACTTCCCCGCCGCCGTCATGGGAAAGATC
CAGGCTTTCCTCGACAACGAGGCCGTCTTCGCCCGGCCCGAGAAGCACCAACACCTGATACAGGAGATGAAGCTC
GAGGCCGCCCTCGTAAGCTGCAACAGTCCCTACGCCGAGGTACGGGCCGTCGTCAGCAACCGCGACGATGTCTCA
ACACCTTGCTCGACGATACGTTCGTGGTCCATCGGCCTCGTCTTCGCCGTCCTCCTCGCCTTCGTCAACCAGCTC
TTCGAGATTCGACAGCCCGCCATCCGCGTCATGGCAAACGTCGCCCAGCTGCTCGCCTATCCGCTCGGCAAGGCG
GCCGAGAACTGGCTACCGGACCGGGCGGTGACCGTCTGGGGCGTCCGCCACTCGCTCAACCCGGGTCCCTTCTCC
AAGAAGGAGCACATGCTCATCACCATCATGGCAAACGTGGCCTACAACACGCCCTACACGAACTACATCATCTGG
GTCCAATTCCTGCCCCAGTACTTCGACCAGCCCTACGCCTCCCACTTCGCCTACCAGCTCCTCATCGCCCTCGCC
ACAAACTTCATCGGCTATGGCATCGCCGGAGTCTGCCGCCGCTTCCTCGTCTACCCTTCCTACTGCGTCTGGCCG
GCCTCCCTCGTCACCATCGCCCTCAACTCGGCCTTCCACACCGACGTCAACCCGCCCGTCGAAGGGCCCCTGCGC
CGCGTCTGGCGACTCTCGCGCATCCGCTTCTTCTACCTCATGTTCGCCTGCATGTTCCTCTGGTTCTGGCTGCCC
GGATACGTCTGGGTCGGCCTGTCCAAGTTCAACTGGCTCGGCTGGATATCGCCGGCCAACCGCCACCTCAACGTG
GTGACGGGCATCAACAACGGCCTCGGCGTCAACCCCTTCCCGACCTGGGACTGGAACGTCCTGCTCTGGGACTCG
GCGGACCCTCTCATGGTGCCCTTCTTCAGCACGCTCAACCGCTTCGTCGGCGTCTTCGCCTCCTTCTGGCTCGTC
CTCGGCCTCTGGTACTCCAACGCCTTCAACACGGGCTACCTCCCCATCAACACCAACCGCGTCTACGACCACTTC
GCCCAGCTCTACAACATCACGCGCGCCACGGACGACCACGGCCTCTTCAACCAGACAAAGTACGAGCGGTACTCG
CCACCCTTCCTCGGCGCCGGCAACATCGTCATCTACGTCTTCTTCTTCGGCATCTACACCTCGACCCTGACGTAC
GCCGCCCTCTACCACCGCCATCAGATCGCAATGGGCTTCAAGGCCCTCTGGCGCAGTCTCCGTCGCCGCCAGCCT
CCCCGTCGCCACTCCCTAGACGTCCACAGCCGCCTCATGGCCGCCTACCCCGAGGTGCCCGACTGGTGGTATCTG
GCCTGCCTCGTCTGCGCCATGGCCTTTGGCGTCGCCGCCATAGCCGCCTGGAACACGCACACGTCGCCCGTCGTC
GTCCTCTACGGCCTCGCCCTCTGCGTCGTCTTCGTCATCCCCGTCGGCATCATCAAGGCCATGACGGGCATCGAG
GTGACGCTCAACGTCCTGGCCGAGTTCGTAGGCGGTTCCTGGGTGGACGGGAACGCGCTGGCCATGAACTACTTC
AAGTCCTTCGGCTACGTCACCTGCGCCCACGCCATCTGGTTCTGCAACGACCTCAAGCTGGCTCACTACGTCAAG
ATCCCCCCCAGACACACCTTCGTCGCCCAGATGGCGGCCACCTTCGTCAGCACCCTCGTCTGCATCGGCGTCCTC
AACTTCCAGATGCTCAGCATCGACGACGTCTGCACCCCCTACGCCCAGTACAAGCTGACGTGCCCCGGCGTCAAC
ACCTTCTTCACCGCCTCGGTCCTCTGGGGAACGGTCGGCCCGGACCGCATCTTCGGTCACCGAGGCCAGTACAGC
GCCGCCCTCGTCGGCTTCCCCCTCGGCGTCGTCATCGTCGTCTTCTTCTGGGTCCTCGGCCGCCGTTTCCCCCGC
TGGGATTGGGTCCGCCAGATCCATCCCGTGGCCATCATGTACGGCGGCATCGTCTGGGCCCCCTACAACATGTCG
TACGTCTGGCCGTCGGTGCCCGTCGCCTGGTTCTCGTGGATCTACCTCAGGTCGCGCTATCTCGGCCTGTGGTCC
AAGTACAACTTCGTCCTCTCCGCCGCCTGGTCATGCGGCATCGCCATCGCCGGCATCATCATCTTCTTCGCCCTG
CAATACACGGGCACCGACCTCGACTGGTGGGGCAACCGCGTCGTCGACGCCGGCTGCGAGGGAAAGGCCTGCACC
CTCAAGACTCTCGCCCCCGGCGAGTATTTCGGCCCACGCATCGGTGATTTCTAG
Gene >Ophcf2|00650
ATGGCCTCCTCTCCCTCCTCGTCCTCCTCTCCGGACGACGACGACAAGAACCGGGCCGTCGCCAACGAAAAGTCA
CGAGACTCGCCCTTTGCCTATGACGAGGACGACGACGACGATGTATGCGCTGGCAGGCTGCGGGCTACGACGGAG
CATGACCTCGACGTCACGGAAGACGACCTCCTCGAAGCAAAGGAGCTGGCTTCGCAGTACACGCTCCAGCAAGTG
CGTCAGGTCATGATCCGGGTGCGGCGCGTACACGAAAAGGATCCCAACTTCCCCGCCGCCGTCATGGGAAAGATC
CAGGCTTTCCTCGACAACGAGGCCGTCTTCGCCCGGCCCGAGAAGCACCAACACCTGATACAGGAGATGAAGCTC
GAGGCCGCCCTCGTAAGCTGCAACAGTCCCTACGCCGAGGTACGGGCCGTCGTCAGCAACCGCGACGATGTCTCA
ACACCTTGCTCGACGATACGTTCGTGGTCCATCGGCCTCGTCTTCGCCGTCCTCCTCGCCTTCGTCAACCAGCTC
TTCGAGATTCGACAGCCCGCCATCCGCGTCATGGCAAACGTCGCCCAGCTGCTCGCCTATCCGCTCGGCAAGGCG
GCCGAGAACTGGCTACCGGACCGGGCGGTGACCGTCTGGGGCGTCCGCCACTCGCTCAACCCGGGTCCCTTCTCC
AAGAAGGAGCACATGCTCATCACCATCATGGCAAACGTGGCCTACAACACGCCCTACACGAACTACATCATCTGG
GTCCAATTCCTGCCCCAGTACTTCGACCAGCCCTACGCCTCCCACTTCGCCTACCAGCTCCTCATCGCCCTCGCC
ACAAACTTCATCGGCTATGGCATCGCCGGAGTCTGCCGCCGCTTCCTCGTCTACCCTTCCTACTGCGTCTGGCCG
GCCTCCCTCGTCACCATCGCCCTCAACTCGGCCTTCCACACCGACGTCAACCCGCCCGTCGAAGGGCCCCTGCGC
CGCGTCTGGCGACTCTCGCGCATCCGCTTCTTCTACCTCATGTTCGCCTGCATGTTCCTCTGGTTCTGGCTGCCC
GGATACGTCTGGGTCGGCCTGTCCAAGTTCAACTGGCTCGGCTGGATATCGCCGGCCAACCGCCACCTCAACGTG
GTGACGGGCATCAACAACGGCCTCGGCGTCAACCCCTTCCCGACCTGGGACTGGAACGTCCTGCTCTGGGACTCG
GCGGACCCTCTCATGGTGCCCTTCTTCAGCACGCTCAACCGCTTCGTCGGCGTCTTCGCCTCCTTCTGGCTCGTC
CTCGGCCTCTGGTACTCCAACGCCTTCAACACGGGCTACCTCCCCATCAACACCAACCGCGTCTACGACCACTTC
GCCCAGCTCTACAACATCACGCGCGCCACGGACGACCACGGCCTCTTCAACCAGACAAAGTACGAGCGGTACTCG
CCACCCTTCCTCGGCGCCGGCAACATCGTCATCTACGTCTTCTTCTTCGGCATCTACACCTCGACCCTGACGTAC
GCCGCCCTCTACCACCGCCATCAGATCGCAATGGGCTTCAAGGCCCTCTGGCGCAGTCTCCGTCGCCGCCAGCCT
CCCCGTCGCCACTCCCTAGACGTCCACAGCCGCCTCATGGCCGCCTACCCCGAGGTGCCCGACTGGTGGTATCTG
GCCTGCCTCGTCTGCGCCATGGCCTTTGGCGTCGCCGCCATAGCCGCCTGGAACACGCACACGTCGCCCGTCGTC
GTCCTCTACGGCCTCGCCCTCTGCGTCGTCTTCGTCATCCCCGTCGGCATCATCAAGGCCATGACGGGCATCGAG
GTGACGCTCAACGTCCTGGCCGAGTTCGTAGGCGGTTCCTGGGTGGACGGGAACGCGCTGGCCATGAACTACTTC
AAGTCCTTCGGCTACGTCACCTGCGCCCACGCCATCTGGTTCTGCAACGACCTCAAGCTGGCTCACTACGTCAAG
ATCCCCCCCAGACACACCTTCGTCGCCCAGATGGCGGCCACCTTCGTCAGCACCCTCGTCTGCATCGGCGTCCTC
AACTTCCAGATGCTCAGCATCGACGACGTCTGCACCCCCTACGCCCAGTACAAGCTGACGTGCCCCGGCGTCAAC
ACCTTCTTCACCGCCTCGGTCCTCTGGGGAACGGTCGGCCCGGACCGCATCTTCGGTCACCGAGGCCAGTACAGC
GCCGCCCTCGTCGGCTTCCCCCTCGGCGTCGTCATCGTCGTCTTCTTCTGGGTCCTCGGCCGCCGTTTCCCCCGC
TGGGATTGGGTCCGCCAGATCCATCCCGTGGCCATCATGTACGGCGGCATCGTCTGGGCCCCCTACAACATGTCG
TACGTCTGGCCGTCGGTGCCCGTCGCCTGGTTCTCGTGGATCTACCTCAGGTCGCGCTATCTCGGCCTGTGGTCC
AAGGTATGCTATGCTATATACGCACACGCACGCACACACTCCTCGTCGACCCTGCAAAAATCAACCACACTGACT
CCCTCCCTCGCAGTACAACTTCGTCCTCTCCGCCGCCTGGTCATGCGGCATCGCCATCGCCGGCATCATCATCTT
CTTCGCCCTGCAATACACGGGCACCGACCTCGACTGGTGGGGCAACCGCGTCGTCGACGCCGGCTGCGAGGGAAA
GGCCTGCACCCTCAAGACTCTCGCCCCCGGCGAGTATTTCGGCCCACGCATCGGTGATTTCTAG

© 2022 - Robin Ohm - Utrecht University - The Netherlands

Built with Python Django and Wagtail