Fungal Genomics

at Utrecht University

General Properties

Protein IDOphcf2|00650
Gene name
Locationscaffold_01:2515458..2518147
Strand-
Gene length (bp)2689
Transcript length (bp)2604
Coding sequence length (bp)2604
Protein length (aa) 868

Overview

Your browser does not support drawing a protein figure.

PFAM Domains

PFAM Domain ID Short name Long name E-value Start End
PF03169 OPT OPT oligopeptide transporter protein 1.4E-167 153 824

GO

GO Term Description Terminal node
GO:0035673 oligopeptide transmembrane transporter activity Yes
GO:1904680 peptide transmembrane transporter activity No
GO:0042887 amide transmembrane transporter activity No
GO:0022857 transmembrane transporter activity No
GO:0003674 molecular_function No
GO:0005215 transporter activity No

Deeploc

[Help with interpreting the results of Deeploc 2.0]
Localizations Signals Cytoplasm Nucleus Extracellular Cell membrane Mitochondrion Plastid Endoplasmic reticulum Lysosome vacuole Golgi apparatus Peroxisome
Cell membrane Transmembrane domain 0.0517 0.1085 0.0948 0.3494 0.1304 0.0372 0.2726 0.3307 0.1489 0.0029

SignalP

(None)

Transmembrane Domains

Domain # Start End Length
1 159 176 17
2 229 251 22
3 266 288 22
4 335 357 22
5 412 434 22
6 479 501 22
7 547 569 22
8 574 593 19
9 656 675 19
10 696 713 17
11 723 745 22
12 766 788 22
13 803 825 22

Transcription Factor Class

(None)

CAZymes

(None)

Secondary Metabolism

(None)

Expression data

Analysis 1: Expression analysis during behavioral modification. Published in: Will et al., G3, 2020

Click here for more information

Orthologs

Orthofinder run ID4
Orthogroup15
Change Orthofinder run
Species Protein ID
Ophiocordyceps australis 1348a (Ghana) OphauG2|2590
Ophiocordyceps australis 1348a (Ghana) OphauG2|606
Ophiocordyceps australis 1348a (Ghana) OphauG2|3939
Ophiocordyceps australis 1348a (Ghana) OphauG2|1382
Ophiocordyceps australis 1348a (Ghana) OphauG2|6610
Ophiocordyceps australis 1348a (Ghana) OphauG2|7306
Ophiocordyceps australis map64 (Brazil) OphauB2|1724
Ophiocordyceps australis map64 (Brazil) OphauB2|2054
Ophiocordyceps australis map64 (Brazil) OphauB2|237
Ophiocordyceps australis map64 (Brazil) OphauB2|6627
Ophiocordyceps australis map64 (Brazil) OphauB2|7003
Ophiocordyceps australis map64 (Brazil) OphauB2|7976
Ophiocordyceps australis map64 (Brazil) OphauB2|4696
Ophiocordyceps camponoti-floridani Ophcf2|05286
Ophiocordyceps camponoti-floridani Ophcf2|06963
Ophiocordyceps camponoti-floridani Ophcf2|00650 (this protein)
Ophiocordyceps camponoti-floridani Ophcf2|01129
Ophiocordyceps camponoti-rufipedis Ophun1|4690
Ophiocordyceps camponoti-rufipedis Ophun1|6856
Ophiocordyceps camponoti-rufipedis Ophun1|719
Ophiocordyceps camponoti-rufipedis Ophun1|7175
Ophiocordyceps kimflemingae Ophio5|2493
Ophiocordyceps kimflemingae Ophio5|7750
Ophiocordyceps kimflemingae Ophio5|7806
Ophiocordyceps subramaniannii Hirsu2|8734
Ophiocordyceps subramaniannii Hirsu2|7618
Ophiocordyceps subramaniannii Hirsu2|5138
Ophiocordyceps subramaniannii Hirsu2|4609
Ophiocordyceps subramaniannii Hirsu2|1511
Ophiocordyceps subramaniannii Hirsu2|10109

Sequences

Type of sequenceSequence
Locus Download genbank file of locus Download genbank file of locus (reverse complement)
The gene with 5 kb flanks (if sufficient flanking sequence is available). For use in cloning design programs. NOTE: features (genes or exons) that are only partially contained within the sequence are completely excluded.
Protein >Ophcf2|00650
MASSPSSSSSPDDDDKNRAVANEKSRDSPFAYDEDDDDDVCAGRLRATTEHDLDVTEDDLLEAKELASQYTLQQV
RQVMIRVRRVHEKDPNFPAAVMGKIQAFLDNEAVFARPEKHQHLIQEMKLEAALVSCNSPYAEVRAVVSNRDDVS
TPCSTIRSWSIGLVFAVLLAFVNQLFEIRQPAIRVMANVAQLLAYPLGKAAENWLPDRAVTVWGVRHSLNPGPFS
KKEHMLITIMANVAYNTPYTNYIIWVQFLPQYFDQPYASHFAYQLLIALATNFIGYGIAGVCRRFLVYPSYCVWP
ASLVTIALNSAFHTDVNPPVEGPLRRVWRLSRIRFFYLMFACMFLWFWLPGYVWVGLSKFNWLGWISPANRHLNV
VTGINNGLGVNPFPTWDWNVLLWDSADPLMVPFFSTLNRFVGVFASFWLVLGLWYSNAFNTGYLPINTNRVYDHF
AQLYNITRATDDHGLFNQTKYERYSPPFLGAGNIVIYVFFFGIYTSTLTYAALYHRHQIAMGFKALWRSLRRRQP
PRRHSLDVHSRLMAAYPEVPDWWYLACLVCAMAFGVAAIAAWNTHTSPVVVLYGLALCVVFVIPVGIIKAMTGIE
VTLNVLAEFVGGSWVDGNALAMNYFKSFGYVTCAHAIWFCNDLKLAHYVKIPPRHTFVAQMAATFVSTLVCIGVL
NFQMLSIDDVCTPYAQYKLTCPGVNTFFTASVLWGTVGPDRIFGHRGQYSAALVGFPLGVVIVVFFWVLGRRFPR
WDWVRQIHPVAIMYGGIVWAPYNMSYVWPSVPVAWFSWIYLRSRYLGLWSKYNFVLSAAWSCGIAIAGIIIFFAL
QYTGTDLDWWGNRVVDAGCEGKACTLKTLAPGEYFGPRIGDF*
Coding >Ophcf2|00650
ATGGCCTCCTCTCCCTCCTCGTCCTCCTCTCCGGACGACGACGACAAGAACCGGGCCGTCGCCAACGAAAAGTCA
CGAGACTCGCCCTTTGCCTATGACGAGGACGACGACGACGATGTATGCGCTGGCAGGCTGCGGGCTACGACGGAG
CATGACCTCGACGTCACGGAAGACGACCTCCTCGAAGCAAAGGAGCTGGCTTCGCAGTACACGCTCCAGCAAGTG
CGTCAGGTCATGATCCGGGTGCGGCGCGTACACGAAAAGGATCCCAACTTCCCCGCCGCCGTCATGGGAAAGATC
CAGGCTTTCCTCGACAACGAGGCCGTCTTCGCCCGGCCCGAGAAGCACCAACACCTGATACAGGAGATGAAGCTC
GAGGCCGCCCTCGTAAGCTGCAACAGTCCCTACGCCGAGGTACGGGCCGTCGTCAGCAACCGCGACGATGTCTCA
ACACCTTGCTCGACGATACGTTCGTGGTCCATCGGCCTCGTCTTCGCCGTCCTCCTCGCCTTCGTCAACCAGCTC
TTCGAGATTCGACAGCCCGCCATCCGCGTCATGGCAAACGTCGCCCAGCTGCTCGCCTATCCGCTCGGCAAGGCG
GCCGAGAACTGGCTACCGGACCGGGCGGTGACCGTCTGGGGCGTCCGCCACTCGCTCAACCCGGGTCCCTTCTCC
AAGAAGGAGCACATGCTCATCACCATCATGGCAAACGTGGCCTACAACACGCCCTACACGAACTACATCATCTGG
GTCCAATTCCTGCCCCAGTACTTCGACCAGCCCTACGCCTCCCACTTCGCCTACCAGCTCCTCATCGCCCTCGCC
ACAAACTTCATCGGCTATGGCATCGCCGGAGTCTGCCGCCGCTTCCTCGTCTACCCTTCCTACTGCGTCTGGCCG
GCCTCCCTCGTCACCATCGCCCTCAACTCGGCCTTCCACACCGACGTCAACCCGCCCGTCGAAGGGCCCCTGCGC
CGCGTCTGGCGACTCTCGCGCATCCGCTTCTTCTACCTCATGTTCGCCTGCATGTTCCTCTGGTTCTGGCTGCCC
GGATACGTCTGGGTCGGCCTGTCCAAGTTCAACTGGCTCGGCTGGATATCGCCGGCCAACCGCCACCTCAACGTG
GTGACGGGCATCAACAACGGCCTCGGCGTCAACCCCTTCCCGACCTGGGACTGGAACGTCCTGCTCTGGGACTCG
GCGGACCCTCTCATGGTGCCCTTCTTCAGCACGCTCAACCGCTTCGTCGGCGTCTTCGCCTCCTTCTGGCTCGTC
CTCGGCCTCTGGTACTCCAACGCCTTCAACACGGGCTACCTCCCCATCAACACCAACCGCGTCTACGACCACTTC
GCCCAGCTCTACAACATCACGCGCGCCACGGACGACCACGGCCTCTTCAACCAGACAAAGTACGAGCGGTACTCG
CCACCCTTCCTCGGCGCCGGCAACATCGTCATCTACGTCTTCTTCTTCGGCATCTACACCTCGACCCTGACGTAC
GCCGCCCTCTACCACCGCCATCAGATCGCAATGGGCTTCAAGGCCCTCTGGCGCAGTCTCCGTCGCCGCCAGCCT
CCCCGTCGCCACTCCCTAGACGTCCACAGCCGCCTCATGGCCGCCTACCCCGAGGTGCCCGACTGGTGGTATCTG
GCCTGCCTCGTCTGCGCCATGGCCTTTGGCGTCGCCGCCATAGCCGCCTGGAACACGCACACGTCGCCCGTCGTC
GTCCTCTACGGCCTCGCCCTCTGCGTCGTCTTCGTCATCCCCGTCGGCATCATCAAGGCCATGACGGGCATCGAG
GTGACGCTCAACGTCCTGGCCGAGTTCGTAGGCGGTTCCTGGGTGGACGGGAACGCGCTGGCCATGAACTACTTC
AAGTCCTTCGGCTACGTCACCTGCGCCCACGCCATCTGGTTCTGCAACGACCTCAAGCTGGCTCACTACGTCAAG
ATCCCCCCCAGACACACCTTCGTCGCCCAGATGGCGGCCACCTTCGTCAGCACCCTCGTCTGCATCGGCGTCCTC
AACTTCCAGATGCTCAGCATCGACGACGTCTGCACCCCCTACGCCCAGTACAAGCTGACGTGCCCCGGCGTCAAC
ACCTTCTTCACCGCCTCGGTCCTCTGGGGAACGGTCGGCCCGGACCGCATCTTCGGTCACCGAGGCCAGTACAGC
GCCGCCCTCGTCGGCTTCCCCCTCGGCGTCGTCATCGTCGTCTTCTTCTGGGTCCTCGGCCGCCGTTTCCCCCGC
TGGGATTGGGTCCGCCAGATCCATCCCGTGGCCATCATGTACGGCGGCATCGTCTGGGCCCCCTACAACATGTCG
TACGTCTGGCCGTCGGTGCCCGTCGCCTGGTTCTCGTGGATCTACCTCAGGTCGCGCTATCTCGGCCTGTGGTCC
AAGTACAACTTCGTCCTCTCCGCCGCCTGGTCATGCGGCATCGCCATCGCCGGCATCATCATCTTCTTCGCCCTG
CAATACACGGGCACCGACCTCGACTGGTGGGGCAACCGCGTCGTCGACGCCGGCTGCGAGGGAAAGGCCTGCACC
CTCAAGACTCTCGCCCCCGGCGAGTATTTCGGCCCACGCATCGGTGATTTCTAG
Transcript >Ophcf2|00650
ATGGCCTCCTCTCCCTCCTCGTCCTCCTCTCCGGACGACGACGACAAGAACCGGGCCGTCGCCAACGAAAAGTCA
CGAGACTCGCCCTTTGCCTATGACGAGGACGACGACGACGATGTATGCGCTGGCAGGCTGCGGGCTACGACGGAG
CATGACCTCGACGTCACGGAAGACGACCTCCTCGAAGCAAAGGAGCTGGCTTCGCAGTACACGCTCCAGCAAGTG
CGTCAGGTCATGATCCGGGTGCGGCGCGTACACGAAAAGGATCCCAACTTCCCCGCCGCCGTCATGGGAAAGATC
CAGGCTTTCCTCGACAACGAGGCCGTCTTCGCCCGGCCCGAGAAGCACCAACACCTGATACAGGAGATGAAGCTC
GAGGCCGCCCTCGTAAGCTGCAACAGTCCCTACGCCGAGGTACGGGCCGTCGTCAGCAACCGCGACGATGTCTCA
ACACCTTGCTCGACGATACGTTCGTGGTCCATCGGCCTCGTCTTCGCCGTCCTCCTCGCCTTCGTCAACCAGCTC
TTCGAGATTCGACAGCCCGCCATCCGCGTCATGGCAAACGTCGCCCAGCTGCTCGCCTATCCGCTCGGCAAGGCG
GCCGAGAACTGGCTACCGGACCGGGCGGTGACCGTCTGGGGCGTCCGCCACTCGCTCAACCCGGGTCCCTTCTCC
AAGAAGGAGCACATGCTCATCACCATCATGGCAAACGTGGCCTACAACACGCCCTACACGAACTACATCATCTGG
GTCCAATTCCTGCCCCAGTACTTCGACCAGCCCTACGCCTCCCACTTCGCCTACCAGCTCCTCATCGCCCTCGCC
ACAAACTTCATCGGCTATGGCATCGCCGGAGTCTGCCGCCGCTTCCTCGTCTACCCTTCCTACTGCGTCTGGCCG
GCCTCCCTCGTCACCATCGCCCTCAACTCGGCCTTCCACACCGACGTCAACCCGCCCGTCGAAGGGCCCCTGCGC
CGCGTCTGGCGACTCTCGCGCATCCGCTTCTTCTACCTCATGTTCGCCTGCATGTTCCTCTGGTTCTGGCTGCCC
GGATACGTCTGGGTCGGCCTGTCCAAGTTCAACTGGCTCGGCTGGATATCGCCGGCCAACCGCCACCTCAACGTG
GTGACGGGCATCAACAACGGCCTCGGCGTCAACCCCTTCCCGACCTGGGACTGGAACGTCCTGCTCTGGGACTCG
GCGGACCCTCTCATGGTGCCCTTCTTCAGCACGCTCAACCGCTTCGTCGGCGTCTTCGCCTCCTTCTGGCTCGTC
CTCGGCCTCTGGTACTCCAACGCCTTCAACACGGGCTACCTCCCCATCAACACCAACCGCGTCTACGACCACTTC
GCCCAGCTCTACAACATCACGCGCGCCACGGACGACCACGGCCTCTTCAACCAGACAAAGTACGAGCGGTACTCG
CCACCCTTCCTCGGCGCCGGCAACATCGTCATCTACGTCTTCTTCTTCGGCATCTACACCTCGACCCTGACGTAC
GCCGCCCTCTACCACCGCCATCAGATCGCAATGGGCTTCAAGGCCCTCTGGCGCAGTCTCCGTCGCCGCCAGCCT
CCCCGTCGCCACTCCCTAGACGTCCACAGCCGCCTCATGGCCGCCTACCCCGAGGTGCCCGACTGGTGGTATCTG
GCCTGCCTCGTCTGCGCCATGGCCTTTGGCGTCGCCGCCATAGCCGCCTGGAACACGCACACGTCGCCCGTCGTC
GTCCTCTACGGCCTCGCCCTCTGCGTCGTCTTCGTCATCCCCGTCGGCATCATCAAGGCCATGACGGGCATCGAG
GTGACGCTCAACGTCCTGGCCGAGTTCGTAGGCGGTTCCTGGGTGGACGGGAACGCGCTGGCCATGAACTACTTC
AAGTCCTTCGGCTACGTCACCTGCGCCCACGCCATCTGGTTCTGCAACGACCTCAAGCTGGCTCACTACGTCAAG
ATCCCCCCCAGACACACCTTCGTCGCCCAGATGGCGGCCACCTTCGTCAGCACCCTCGTCTGCATCGGCGTCCTC
AACTTCCAGATGCTCAGCATCGACGACGTCTGCACCCCCTACGCCCAGTACAAGCTGACGTGCCCCGGCGTCAAC
ACCTTCTTCACCGCCTCGGTCCTCTGGGGAACGGTCGGCCCGGACCGCATCTTCGGTCACCGAGGCCAGTACAGC
GCCGCCCTCGTCGGCTTCCCCCTCGGCGTCGTCATCGTCGTCTTCTTCTGGGTCCTCGGCCGCCGTTTCCCCCGC
TGGGATTGGGTCCGCCAGATCCATCCCGTGGCCATCATGTACGGCGGCATCGTCTGGGCCCCCTACAACATGTCG
TACGTCTGGCCGTCGGTGCCCGTCGCCTGGTTCTCGTGGATCTACCTCAGGTCGCGCTATCTCGGCCTGTGGTCC
AAGTACAACTTCGTCCTCTCCGCCGCCTGGTCATGCGGCATCGCCATCGCCGGCATCATCATCTTCTTCGCCCTG
CAATACACGGGCACCGACCTCGACTGGTGGGGCAACCGCGTCGTCGACGCCGGCTGCGAGGGAAAGGCCTGCACC
CTCAAGACTCTCGCCCCCGGCGAGTATTTCGGCCCACGCATCGGTGATTTCTAG
Gene >Ophcf2|00650
ATGGCCTCCTCTCCCTCCTCGTCCTCCTCTCCGGACGACGACGACAAGAACCGGGCCGTCGCCAACGAAAAGTCA
CGAGACTCGCCCTTTGCCTATGACGAGGACGACGACGACGATGTATGCGCTGGCAGGCTGCGGGCTACGACGGAG
CATGACCTCGACGTCACGGAAGACGACCTCCTCGAAGCAAAGGAGCTGGCTTCGCAGTACACGCTCCAGCAAGTG
CGTCAGGTCATGATCCGGGTGCGGCGCGTACACGAAAAGGATCCCAACTTCCCCGCCGCCGTCATGGGAAAGATC
CAGGCTTTCCTCGACAACGAGGCCGTCTTCGCCCGGCCCGAGAAGCACCAACACCTGATACAGGAGATGAAGCTC
GAGGCCGCCCTCGTAAGCTGCAACAGTCCCTACGCCGAGGTACGGGCCGTCGTCAGCAACCGCGACGATGTCTCA
ACACCTTGCTCGACGATACGTTCGTGGTCCATCGGCCTCGTCTTCGCCGTCCTCCTCGCCTTCGTCAACCAGCTC
TTCGAGATTCGACAGCCCGCCATCCGCGTCATGGCAAACGTCGCCCAGCTGCTCGCCTATCCGCTCGGCAAGGCG
GCCGAGAACTGGCTACCGGACCGGGCGGTGACCGTCTGGGGCGTCCGCCACTCGCTCAACCCGGGTCCCTTCTCC
AAGAAGGAGCACATGCTCATCACCATCATGGCAAACGTGGCCTACAACACGCCCTACACGAACTACATCATCTGG
GTCCAATTCCTGCCCCAGTACTTCGACCAGCCCTACGCCTCCCACTTCGCCTACCAGCTCCTCATCGCCCTCGCC
ACAAACTTCATCGGCTATGGCATCGCCGGAGTCTGCCGCCGCTTCCTCGTCTACCCTTCCTACTGCGTCTGGCCG
GCCTCCCTCGTCACCATCGCCCTCAACTCGGCCTTCCACACCGACGTCAACCCGCCCGTCGAAGGGCCCCTGCGC
CGCGTCTGGCGACTCTCGCGCATCCGCTTCTTCTACCTCATGTTCGCCTGCATGTTCCTCTGGTTCTGGCTGCCC
GGATACGTCTGGGTCGGCCTGTCCAAGTTCAACTGGCTCGGCTGGATATCGCCGGCCAACCGCCACCTCAACGTG
GTGACGGGCATCAACAACGGCCTCGGCGTCAACCCCTTCCCGACCTGGGACTGGAACGTCCTGCTCTGGGACTCG
GCGGACCCTCTCATGGTGCCCTTCTTCAGCACGCTCAACCGCTTCGTCGGCGTCTTCGCCTCCTTCTGGCTCGTC
CTCGGCCTCTGGTACTCCAACGCCTTCAACACGGGCTACCTCCCCATCAACACCAACCGCGTCTACGACCACTTC
GCCCAGCTCTACAACATCACGCGCGCCACGGACGACCACGGCCTCTTCAACCAGACAAAGTACGAGCGGTACTCG
CCACCCTTCCTCGGCGCCGGCAACATCGTCATCTACGTCTTCTTCTTCGGCATCTACACCTCGACCCTGACGTAC
GCCGCCCTCTACCACCGCCATCAGATCGCAATGGGCTTCAAGGCCCTCTGGCGCAGTCTCCGTCGCCGCCAGCCT
CCCCGTCGCCACTCCCTAGACGTCCACAGCCGCCTCATGGCCGCCTACCCCGAGGTGCCCGACTGGTGGTATCTG
GCCTGCCTCGTCTGCGCCATGGCCTTTGGCGTCGCCGCCATAGCCGCCTGGAACACGCACACGTCGCCCGTCGTC
GTCCTCTACGGCCTCGCCCTCTGCGTCGTCTTCGTCATCCCCGTCGGCATCATCAAGGCCATGACGGGCATCGAG
GTGACGCTCAACGTCCTGGCCGAGTTCGTAGGCGGTTCCTGGGTGGACGGGAACGCGCTGGCCATGAACTACTTC
AAGTCCTTCGGCTACGTCACCTGCGCCCACGCCATCTGGTTCTGCAACGACCTCAAGCTGGCTCACTACGTCAAG
ATCCCCCCCAGACACACCTTCGTCGCCCAGATGGCGGCCACCTTCGTCAGCACCCTCGTCTGCATCGGCGTCCTC
AACTTCCAGATGCTCAGCATCGACGACGTCTGCACCCCCTACGCCCAGTACAAGCTGACGTGCCCCGGCGTCAAC
ACCTTCTTCACCGCCTCGGTCCTCTGGGGAACGGTCGGCCCGGACCGCATCTTCGGTCACCGAGGCCAGTACAGC
GCCGCCCTCGTCGGCTTCCCCCTCGGCGTCGTCATCGTCGTCTTCTTCTGGGTCCTCGGCCGCCGTTTCCCCCGC
TGGGATTGGGTCCGCCAGATCCATCCCGTGGCCATCATGTACGGCGGCATCGTCTGGGCCCCCTACAACATGTCG
TACGTCTGGCCGTCGGTGCCCGTCGCCTGGTTCTCGTGGATCTACCTCAGGTCGCGCTATCTCGGCCTGTGGTCC
AAGGTATGCTATGCTATATACGCACACGCACGCACACACTCCTCGTCGACCCTGCAAAAATCAACCACACTGACT
CCCTCCCTCGCAGTACAACTTCGTCCTCTCCGCCGCCTGGTCATGCGGCATCGCCATCGCCGGCATCATCATCTT
CTTCGCCCTGCAATACACGGGCACCGACCTCGACTGGTGGGGCAACCGCGTCGTCGACGCCGGCTGCGAGGGAAA
GGCCTGCACCCTCAAGACTCTCGCCCCCGGCGAGTATTTCGGCCCACGCATCGGTGATTTCTAG

© 2023 - Robin Ohm - Utrecht University - The Netherlands

Built with Python Django and Wagtail