Fungal Genomics

at Utrecht University

General Properties

Protein IDOphcf2|00650
Gene name
Locationscaffold_01:2515458..2518147
Strand-
Gene length (bp)2689
Transcript length (bp)2604
Coding sequence length (bp)2604
Protein length (aa) 868

Your browser does not support drawing a protein figure.

PFAM Domains

PFAM Domain ID Short name Long name E-value Start End
PF03169 OPT OPT oligopeptide transporter protein 1.4E-167 153 824

GO

GO Term Description Terminal node
GO:0035673 oligopeptide transmembrane transporter activity Yes
GO:1904680 peptide transmembrane transporter activity No
GO:0042887 amide transmembrane transporter activity No
GO:0022857 transmembrane transporter activity No
GO:0003674 molecular_function No
GO:0005215 transporter activity No

SignalP

[Help with interpreting these statistics]
SignalP signal predicted Location
(based on Ymax)
D score
(significance: > 0.45)
No 1 - 41 0.45

Transmembrane Domains

Domain # Start End Length
1 159 176 17
2 229 251 22
3 266 288 22
4 335 357 22
5 412 434 22
6 479 501 22
7 547 569 22
8 574 593 19
9 656 675 19
10 696 713 17
11 723 745 22
12 766 788 22
13 803 825 22

Transcription Factor Class

(None)

Expression data

Analysis 1: Expression analysis during behavioral modification. Published in: Will et al., G3, 2020

Click here for more information

Sequences

Type of sequenceSequence
Locus Download genbank file of locus
The gene with 5 kb flanks (if sufficient flanking sequence is available). For use in cloning design programs. NOTE: features (genes or exons) that are only partially contained within the sequence are completely excluded.
Protein >Ophcf2|00650
MASSPSSSSSPDDDDKNRAVANEKSRDSPFAYDEDDDDDVCAGRLRATTEHDLDVTEDDLLEAKELASQYTLQQV
RQVMIRVRRVHEKDPNFPAAVMGKIQAFLDNEAVFARPEKHQHLIQEMKLEAALVSCNSPYAEVRAVVSNRDDVS
TPCSTIRSWSIGLVFAVLLAFVNQLFEIRQPAIRVMANVAQLLAYPLGKAAENWLPDRAVTVWGVRHSLNPGPFS
KKEHMLITIMANVAYNTPYTNYIIWVQFLPQYFDQPYASHFAYQLLIALATNFIGYGIAGVCRRFLVYPSYCVWP
ASLVTIALNSAFHTDVNPPVEGPLRRVWRLSRIRFFYLMFACMFLWFWLPGYVWVGLSKFNWLGWISPANRHLNV
VTGINNGLGVNPFPTWDWNVLLWDSADPLMVPFFSTLNRFVGVFASFWLVLGLWYSNAFNTGYLPINTNRVYDHF
AQLYNITRATDDHGLFNQTKYERYSPPFLGAGNIVIYVFFFGIYTSTLTYAALYHRHQIAMGFKALWRSLRRRQP
PRRHSLDVHSRLMAAYPEVPDWWYLACLVCAMAFGVAAIAAWNTHTSPVVVLYGLALCVVFVIPVGIIKAMTGIE
VTLNVLAEFVGGSWVDGNALAMNYFKSFGYVTCAHAIWFCNDLKLAHYVKIPPRHTFVAQMAATFVSTLVCIGVL
NFQMLSIDDVCTPYAQYKLTCPGVNTFFTASVLWGTVGPDRIFGHRGQYSAALVGFPLGVVIVVFFWVLGRRFPR
WDWVRQIHPVAIMYGGIVWAPYNMSYVWPSVPVAWFSWIYLRSRYLGLWSKYNFVLSAAWSCGIAIAGIIIFFAL
QYTGTDLDWWGNRVVDAGCEGKACTLKTLAPGEYFGPRIGDF*
Coding >Ophcf2|00650
ATGGCCTCCTCTCCCTCCTCGTCCTCCTCTCCGGACGACGACGACAAGAACCGGGCCGTCGCCAACGAAAAGTCA
CGAGACTCGCCCTTTGCCTATGACGAGGACGACGACGACGATGTATGCGCTGGCAGGCTGCGGGCTACGACGGAG
CATGACCTCGACGTCACGGAAGACGACCTCCTCGAAGCAAAGGAGCTGGCTTCGCAGTACACGCTCCAGCAAGTG
CGTCAGGTCATGATCCGGGTGCGGCGCGTACACGAAAAGGATCCCAACTTCCCCGCCGCCGTCATGGGAAAGATC
CAGGCTTTCCTCGACAACGAGGCCGTCTTCGCCCGGCCCGAGAAGCACCAACACCTGATACAGGAGATGAAGCTC
GAGGCCGCCCTCGTAAGCTGCAACAGTCCCTACGCCGAGGTACGGGCCGTCGTCAGCAACCGCGACGATGTCTCA
ACACCTTGCTCGACGATACGTTCGTGGTCCATCGGCCTCGTCTTCGCCGTCCTCCTCGCCTTCGTCAACCAGCTC
TTCGAGATTCGACAGCCCGCCATCCGCGTCATGGCAAACGTCGCCCAGCTGCTCGCCTATCCGCTCGGCAAGGCG
GCCGAGAACTGGCTACCGGACCGGGCGGTGACCGTCTGGGGCGTCCGCCACTCGCTCAACCCGGGTCCCTTCTCC
AAGAAGGAGCACATGCTCATCACCATCATGGCAAACGTGGCCTACAACACGCCCTACACGAACTACATCATCTGG
GTCCAATTCCTGCCCCAGTACTTCGACCAGCCCTACGCCTCCCACTTCGCCTACCAGCTCCTCATCGCCCTCGCC
ACAAACTTCATCGGCTATGGCATCGCCGGAGTCTGCCGCCGCTTCCTCGTCTACCCTTCCTACTGCGTCTGGCCG
GCCTCCCTCGTCACCATCGCCCTCAACTCGGCCTTCCACACCGACGTCAACCCGCCCGTCGAAGGGCCCCTGCGC
CGCGTCTGGCGACTCTCGCGCATCCGCTTCTTCTACCTCATGTTCGCCTGCATGTTCCTCTGGTTCTGGCTGCCC
GGATACGTCTGGGTCGGCCTGTCCAAGTTCAACTGGCTCGGCTGGATATCGCCGGCCAACCGCCACCTCAACGTG
GTGACGGGCATCAACAACGGCCTCGGCGTCAACCCCTTCCCGACCTGGGACTGGAACGTCCTGCTCTGGGACTCG
GCGGACCCTCTCATGGTGCCCTTCTTCAGCACGCTCAACCGCTTCGTCGGCGTCTTCGCCTCCTTCTGGCTCGTC
CTCGGCCTCTGGTACTCCAACGCCTTCAACACGGGCTACCTCCCCATCAACACCAACCGCGTCTACGACCACTTC
GCCCAGCTCTACAACATCACGCGCGCCACGGACGACCACGGCCTCTTCAACCAGACAAAGTACGAGCGGTACTCG
CCACCCTTCCTCGGCGCCGGCAACATCGTCATCTACGTCTTCTTCTTCGGCATCTACACCTCGACCCTGACGTAC
GCCGCCCTCTACCACCGCCATCAGATCGCAATGGGCTTCAAGGCCCTCTGGCGCAGTCTCCGTCGCCGCCAGCCT
CCCCGTCGCCACTCCCTAGACGTCCACAGCCGCCTCATGGCCGCCTACCCCGAGGTGCCCGACTGGTGGTATCTG
GCCTGCCTCGTCTGCGCCATGGCCTTTGGCGTCGCCGCCATAGCCGCCTGGAACACGCACACGTCGCCCGTCGTC
GTCCTCTACGGCCTCGCCCTCTGCGTCGTCTTCGTCATCCCCGTCGGCATCATCAAGGCCATGACGGGCATCGAG
GTGACGCTCAACGTCCTGGCCGAGTTCGTAGGCGGTTCCTGGGTGGACGGGAACGCGCTGGCCATGAACTACTTC
AAGTCCTTCGGCTACGTCACCTGCGCCCACGCCATCTGGTTCTGCAACGACCTCAAGCTGGCTCACTACGTCAAG
ATCCCCCCCAGACACACCTTCGTCGCCCAGATGGCGGCCACCTTCGTCAGCACCCTCGTCTGCATCGGCGTCCTC
AACTTCCAGATGCTCAGCATCGACGACGTCTGCACCCCCTACGCCCAGTACAAGCTGACGTGCCCCGGCGTCAAC
ACCTTCTTCACCGCCTCGGTCCTCTGGGGAACGGTCGGCCCGGACCGCATCTTCGGTCACCGAGGCCAGTACAGC
GCCGCCCTCGTCGGCTTCCCCCTCGGCGTCGTCATCGTCGTCTTCTTCTGGGTCCTCGGCCGCCGTTTCCCCCGC
TGGGATTGGGTCCGCCAGATCCATCCCGTGGCCATCATGTACGGCGGCATCGTCTGGGCCCCCTACAACATGTCG
TACGTCTGGCCGTCGGTGCCCGTCGCCTGGTTCTCGTGGATCTACCTCAGGTCGCGCTATCTCGGCCTGTGGTCC
AAGTACAACTTCGTCCTCTCCGCCGCCTGGTCATGCGGCATCGCCATCGCCGGCATCATCATCTTCTTCGCCCTG
CAATACACGGGCACCGACCTCGACTGGTGGGGCAACCGCGTCGTCGACGCCGGCTGCGAGGGAAAGGCCTGCACC
CTCAAGACTCTCGCCCCCGGCGAGTATTTCGGCCCACGCATCGGTGATTTCTAG
Transcript >Ophcf2|00650
ATGGCCTCCTCTCCCTCCTCGTCCTCCTCTCCGGACGACGACGACAAGAACCGGGCCGTCGCCAACGAAAAGTCA
CGAGACTCGCCCTTTGCCTATGACGAGGACGACGACGACGATGTATGCGCTGGCAGGCTGCGGGCTACGACGGAG
CATGACCTCGACGTCACGGAAGACGACCTCCTCGAAGCAAAGGAGCTGGCTTCGCAGTACACGCTCCAGCAAGTG
CGTCAGGTCATGATCCGGGTGCGGCGCGTACACGAAAAGGATCCCAACTTCCCCGCCGCCGTCATGGGAAAGATC
CAGGCTTTCCTCGACAACGAGGCCGTCTTCGCCCGGCCCGAGAAGCACCAACACCTGATACAGGAGATGAAGCTC
GAGGCCGCCCTCGTAAGCTGCAACAGTCCCTACGCCGAGGTACGGGCCGTCGTCAGCAACCGCGACGATGTCTCA
ACACCTTGCTCGACGATACGTTCGTGGTCCATCGGCCTCGTCTTCGCCGTCCTCCTCGCCTTCGTCAACCAGCTC
TTCGAGATTCGACAGCCCGCCATCCGCGTCATGGCAAACGTCGCCCAGCTGCTCGCCTATCCGCTCGGCAAGGCG
GCCGAGAACTGGCTACCGGACCGGGCGGTGACCGTCTGGGGCGTCCGCCACTCGCTCAACCCGGGTCCCTTCTCC
AAGAAGGAGCACATGCTCATCACCATCATGGCAAACGTGGCCTACAACACGCCCTACACGAACTACATCATCTGG
GTCCAATTCCTGCCCCAGTACTTCGACCAGCCCTACGCCTCCCACTTCGCCTACCAGCTCCTCATCGCCCTCGCC
ACAAACTTCATCGGCTATGGCATCGCCGGAGTCTGCCGCCGCTTCCTCGTCTACCCTTCCTACTGCGTCTGGCCG
GCCTCCCTCGTCACCATCGCCCTCAACTCGGCCTTCCACACCGACGTCAACCCGCCCGTCGAAGGGCCCCTGCGC
CGCGTCTGGCGACTCTCGCGCATCCGCTTCTTCTACCTCATGTTCGCCTGCATGTTCCTCTGGTTCTGGCTGCCC
GGATACGTCTGGGTCGGCCTGTCCAAGTTCAACTGGCTCGGCTGGATATCGCCGGCCAACCGCCACCTCAACGTG
GTGACGGGCATCAACAACGGCCTCGGCGTCAACCCCTTCCCGACCTGGGACTGGAACGTCCTGCTCTGGGACTCG
GCGGACCCTCTCATGGTGCCCTTCTTCAGCACGCTCAACCGCTTCGTCGGCGTCTTCGCCTCCTTCTGGCTCGTC
CTCGGCCTCTGGTACTCCAACGCCTTCAACACGGGCTACCTCCCCATCAACACCAACCGCGTCTACGACCACTTC
GCCCAGCTCTACAACATCACGCGCGCCACGGACGACCACGGCCTCTTCAACCAGACAAAGTACGAGCGGTACTCG
CCACCCTTCCTCGGCGCCGGCAACATCGTCATCTACGTCTTCTTCTTCGGCATCTACACCTCGACCCTGACGTAC
GCCGCCCTCTACCACCGCCATCAGATCGCAATGGGCTTCAAGGCCCTCTGGCGCAGTCTCCGTCGCCGCCAGCCT
CCCCGTCGCCACTCCCTAGACGTCCACAGCCGCCTCATGGCCGCCTACCCCGAGGTGCCCGACTGGTGGTATCTG
GCCTGCCTCGTCTGCGCCATGGCCTTTGGCGTCGCCGCCATAGCCGCCTGGAACACGCACACGTCGCCCGTCGTC
GTCCTCTACGGCCTCGCCCTCTGCGTCGTCTTCGTCATCCCCGTCGGCATCATCAAGGCCATGACGGGCATCGAG
GTGACGCTCAACGTCCTGGCCGAGTTCGTAGGCGGTTCCTGGGTGGACGGGAACGCGCTGGCCATGAACTACTTC
AAGTCCTTCGGCTACGTCACCTGCGCCCACGCCATCTGGTTCTGCAACGACCTCAAGCTGGCTCACTACGTCAAG
ATCCCCCCCAGACACACCTTCGTCGCCCAGATGGCGGCCACCTTCGTCAGCACCCTCGTCTGCATCGGCGTCCTC
AACTTCCAGATGCTCAGCATCGACGACGTCTGCACCCCCTACGCCCAGTACAAGCTGACGTGCCCCGGCGTCAAC
ACCTTCTTCACCGCCTCGGTCCTCTGGGGAACGGTCGGCCCGGACCGCATCTTCGGTCACCGAGGCCAGTACAGC
GCCGCCCTCGTCGGCTTCCCCCTCGGCGTCGTCATCGTCGTCTTCTTCTGGGTCCTCGGCCGCCGTTTCCCCCGC
TGGGATTGGGTCCGCCAGATCCATCCCGTGGCCATCATGTACGGCGGCATCGTCTGGGCCCCCTACAACATGTCG
TACGTCTGGCCGTCGGTGCCCGTCGCCTGGTTCTCGTGGATCTACCTCAGGTCGCGCTATCTCGGCCTGTGGTCC
AAGTACAACTTCGTCCTCTCCGCCGCCTGGTCATGCGGCATCGCCATCGCCGGCATCATCATCTTCTTCGCCCTG
CAATACACGGGCACCGACCTCGACTGGTGGGGCAACCGCGTCGTCGACGCCGGCTGCGAGGGAAAGGCCTGCACC
CTCAAGACTCTCGCCCCCGGCGAGTATTTCGGCCCACGCATCGGTGATTTCTAG
Gene >Ophcf2|00650
ATGGCCTCCTCTCCCTCCTCGTCCTCCTCTCCGGACGACGACGACAAGAACCGGGCCGTCGCCAACGAAAAGTCA
CGAGACTCGCCCTTTGCCTATGACGAGGACGACGACGACGATGTATGCGCTGGCAGGCTGCGGGCTACGACGGAG
CATGACCTCGACGTCACGGAAGACGACCTCCTCGAAGCAAAGGAGCTGGCTTCGCAGTACACGCTCCAGCAAGTG
CGTCAGGTCATGATCCGGGTGCGGCGCGTACACGAAAAGGATCCCAACTTCCCCGCCGCCGTCATGGGAAAGATC
CAGGCTTTCCTCGACAACGAGGCCGTCTTCGCCCGGCCCGAGAAGCACCAACACCTGATACAGGAGATGAAGCTC
GAGGCCGCCCTCGTAAGCTGCAACAGTCCCTACGCCGAGGTACGGGCCGTCGTCAGCAACCGCGACGATGTCTCA
ACACCTTGCTCGACGATACGTTCGTGGTCCATCGGCCTCGTCTTCGCCGTCCTCCTCGCCTTCGTCAACCAGCTC
TTCGAGATTCGACAGCCCGCCATCCGCGTCATGGCAAACGTCGCCCAGCTGCTCGCCTATCCGCTCGGCAAGGCG
GCCGAGAACTGGCTACCGGACCGGGCGGTGACCGTCTGGGGCGTCCGCCACTCGCTCAACCCGGGTCCCTTCTCC
AAGAAGGAGCACATGCTCATCACCATCATGGCAAACGTGGCCTACAACACGCCCTACACGAACTACATCATCTGG
GTCCAATTCCTGCCCCAGTACTTCGACCAGCCCTACGCCTCCCACTTCGCCTACCAGCTCCTCATCGCCCTCGCC
ACAAACTTCATCGGCTATGGCATCGCCGGAGTCTGCCGCCGCTTCCTCGTCTACCCTTCCTACTGCGTCTGGCCG
GCCTCCCTCGTCACCATCGCCCTCAACTCGGCCTTCCACACCGACGTCAACCCGCCCGTCGAAGGGCCCCTGCGC
CGCGTCTGGCGACTCTCGCGCATCCGCTTCTTCTACCTCATGTTCGCCTGCATGTTCCTCTGGTTCTGGCTGCCC
GGATACGTCTGGGTCGGCCTGTCCAAGTTCAACTGGCTCGGCTGGATATCGCCGGCCAACCGCCACCTCAACGTG
GTGACGGGCATCAACAACGGCCTCGGCGTCAACCCCTTCCCGACCTGGGACTGGAACGTCCTGCTCTGGGACTCG
GCGGACCCTCTCATGGTGCCCTTCTTCAGCACGCTCAACCGCTTCGTCGGCGTCTTCGCCTCCTTCTGGCTCGTC
CTCGGCCTCTGGTACTCCAACGCCTTCAACACGGGCTACCTCCCCATCAACACCAACCGCGTCTACGACCACTTC
GCCCAGCTCTACAACATCACGCGCGCCACGGACGACCACGGCCTCTTCAACCAGACAAAGTACGAGCGGTACTCG
CCACCCTTCCTCGGCGCCGGCAACATCGTCATCTACGTCTTCTTCTTCGGCATCTACACCTCGACCCTGACGTAC
GCCGCCCTCTACCACCGCCATCAGATCGCAATGGGCTTCAAGGCCCTCTGGCGCAGTCTCCGTCGCCGCCAGCCT
CCCCGTCGCCACTCCCTAGACGTCCACAGCCGCCTCATGGCCGCCTACCCCGAGGTGCCCGACTGGTGGTATCTG
GCCTGCCTCGTCTGCGCCATGGCCTTTGGCGTCGCCGCCATAGCCGCCTGGAACACGCACACGTCGCCCGTCGTC
GTCCTCTACGGCCTCGCCCTCTGCGTCGTCTTCGTCATCCCCGTCGGCATCATCAAGGCCATGACGGGCATCGAG
GTGACGCTCAACGTCCTGGCCGAGTTCGTAGGCGGTTCCTGGGTGGACGGGAACGCGCTGGCCATGAACTACTTC
AAGTCCTTCGGCTACGTCACCTGCGCCCACGCCATCTGGTTCTGCAACGACCTCAAGCTGGCTCACTACGTCAAG
ATCCCCCCCAGACACACCTTCGTCGCCCAGATGGCGGCCACCTTCGTCAGCACCCTCGTCTGCATCGGCGTCCTC
AACTTCCAGATGCTCAGCATCGACGACGTCTGCACCCCCTACGCCCAGTACAAGCTGACGTGCCCCGGCGTCAAC
ACCTTCTTCACCGCCTCGGTCCTCTGGGGAACGGTCGGCCCGGACCGCATCTTCGGTCACCGAGGCCAGTACAGC
GCCGCCCTCGTCGGCTTCCCCCTCGGCGTCGTCATCGTCGTCTTCTTCTGGGTCCTCGGCCGCCGTTTCCCCCGC
TGGGATTGGGTCCGCCAGATCCATCCCGTGGCCATCATGTACGGCGGCATCGTCTGGGCCCCCTACAACATGTCG
TACGTCTGGCCGTCGGTGCCCGTCGCCTGGTTCTCGTGGATCTACCTCAGGTCGCGCTATCTCGGCCTGTGGTCC
AAGGTATGCTATGCTATATACGCACACGCACGCACACACTCCTCGTCGACCCTGCAAAAATCAACCACACTGACT
CCCTCCCTCGCAGTACAACTTCGTCCTCTCCGCCGCCTGGTCATGCGGCATCGCCATCGCCGGCATCATCATCTT
CTTCGCCCTGCAATACACGGGCACCGACCTCGACTGGTGGGGCAACCGCGTCGTCGACGCCGGCTGCGAGGGAAA
GGCCTGCACCCTCAAGACTCTCGCCCCCGGCGAGTATTTCGGCCCACGCATCGGTGATTTCTAG

© 2022 - Robin Ohm - Utrecht University - The Netherlands

Built with Python Django and Wagtail