Fungal Genomics

at Utrecht University

General Properties

Protein IDOphcf2|00647
Gene name
Locationscaffold_01:2506720..2509027
Strand+
Gene length (bp)2307
Transcript length (bp)2307
Coding sequence length (bp)2307
Protein length (aa) 769

Overview

Your browser does not support drawing a protein figure.

PFAM Domains

PFAM Domain ID Short name Long name E-value Start End
PF07842 GCFC GC-rich sequence DNA-binding factor-like protein 6.6E-62 451 719
PF01585 G-patch G-patch domain 5.3E-13 210 252
PF12457 TIP_N Tuftelin interacting protein N terminal 1.6E-10 38 123
PF12656 G-patch_2 G-patch domain 1.1E-06 211 254

GO

GO Term Description Terminal node
GO:0003676 nucleic acid binding Yes
GO:1901363 heterocyclic compound binding No
GO:0003674 molecular_function No
GO:0005488 binding No
GO:0097159 organic cyclic compound binding No

Deeploc

[Help with interpreting the results of Deeploc 2.0]
Localizations Signals Cytoplasm Nucleus Extracellular Cell membrane Mitochondrion Plastid Endoplasmic reticulum Lysosome vacuole Golgi apparatus Peroxisome
Nucleus Nuclear localization signal 0.3522 0.7375 0.5989 0.0389 0.0878 0.0091 0.0119 0.0234 0.0304 0.0009

SignalP

(None)

Transmembrane Domains

(None)

Transcription Factor Class

(None)

CAZymes

(None)

Secondary Metabolism

(None)

Expression data

Analysis 1: Expression analysis during behavioral modification. Published in: Will et al., G3, 2020

Click here for more information

Orthologs

Orthofinder run ID4
Orthogroup3073
Change Orthofinder run
Species Protein ID
Ophiocordyceps australis 1348a (Ghana) OphauG2|3935
Ophiocordyceps australis map64 (Brazil) OphauB2|7979
Ophiocordyceps camponoti-floridani Ophcf2|00647 (this protein)
Ophiocordyceps camponoti-rufipedis Ophun1|2023
Ophiocordyceps kimflemingae Ophio5|4138
Ophiocordyceps subramaniannii Hirsu2|5334

Sequences

Type of sequenceSequence
Locus Download genbank file of locus Download genbank file of locus (reverse complement)
The gene with 5 kb flanks (if sufficient flanking sequence is available). For use in cloning design programs. NOTE: features (genes or exons) that are only partially contained within the sequence are completely excluded.
Protein >Ophcf2|00647
MDGSPRLAFDPSRVTKASATDYSSSESESEDEHVLPGVDNDFGDYNPRKKRRIGVNGKEKAALGIFGSDSDDDRP
GQRWKGKTLRRKGVSFVSTDAQGVQGGEESDILESHPESSDGNPDSDYDDDEAEPGAGLGFSKTARTANGSRKQE
QNSPAAEAKPILGKKGIVFRASVPPANAPVLTQKAMDSTPPIRNKPQPSAFGSKGKINAKSFGARMMAKMGYVDG
MGLGKEGQGRNVVIEANLRPQGIGLGAVKEKTESERKEEKRQAQLRGEVVIDSDEEEKRRKKAKKMSRGIAGRSA
SGTPRRQKTKYITAEELKAAAPGLHIPDAFTPILDMTGPEGKLITSASGVMTPRGGVAEPDEVVEARKLVKRAQA
ELMAFSEEWRSLEERKSWLRLELREREQEVDDLRSELGRLQNLSAIVAEQLTQASDWNQVVACLEKAVSLGNVMP
EVADVAVAAMHPFLKAADWKPLEEPDRFASDLKRLSSLFTKSETGGDGKTINKWDSRAAKADGVYRQHRKATTSY
ESMMYKLWLPRVLAAIREWDALTPGPMVSVVEAWDDIMPPFVRTQVMESIGRKLESALADWNPRKKKQLPHTWLF
PWLPLLPAYHLDVRGTGLVADVKRKLRQLVDGWDFERGIVPGLQQWQEVLGNEWRPLMMSHVLPSMSRCLRARFR
VDPADQEPYLPVLVGALEWQAMLGDAVMGEMVVQTVLPMWNAKLQAWLALEEADLAEVADWYGWWRGMMLKKLAG
TQMVSEELDKGLRIMMML*
Coding >Ophcf2|00647
ATGGACGGATCTCCGCGCCTCGCCTTTGATCCGTCACGTGTCACCAAAGCTTCCGCGACAGACTATTCTTCGTCC
GAATCCGAATCCGAGGACGAACATGTCCTGCCTGGTGTTGACAACGACTTTGGCGATTACAACCCTCGGAAAAAG
CGTCGCATCGGGGTAAACGGCAAGGAAAAGGCGGCTCTAGGGATATTTGGTTCGGATAGCGACGACGATCGTCCC
GGCCAGCGATGGAAGGGCAAGACGTTGAGGCGCAAGGGAGTGAGCTTCGTTTCCACCGACGCGCAGGGTGTCCAA
GGTGGCGAAGAAAGCGACATCCTCGAGAGTCATCCGGAATCAAGCGACGGAAATCCGGATAGTGACTACGATGAC
GATGAAGCCGAACCAGGCGCTGGCTTGGGGTTCAGCAAGACGGCACGGACGGCAAATGGCTCGCGAAAGCAGGAG
CAGAATTCGCCTGCTGCTGAGGCAAAGCCGATACTCGGAAAAAAGGGCATCGTCTTTCGCGCATCGGTGCCGCCA
GCGAACGCGCCGGTTCTCACACAGAAAGCCATGGATAGCACACCTCCTATCCGTAACAAGCCTCAGCCAAGCGCG
TTCGGGAGTAAGGGCAAGATTAACGCCAAATCATTCGGCGCCCGCATGATGGCCAAGATGGGCTACGTCGACGGC
ATGGGCCTCGGCAAGGAGGGACAGGGAAGAAATGTCGTTATCGAGGCGAACCTGCGACCTCAAGGTATTGGTTTG
GGGGCGGTGAAGGAGAAGACGGAGAGTGAACGAAAAGAGGAGAAACGACAGGCCCAGTTGCGAGGCGAGGTCGTC
ATCGACTCGGACGAGGAAGAGAAGCGACGGAAAAAGGCCAAGAAGATGTCTCGGGGCATTGCTGGCAGAAGCGCT
TCCGGTACGCCTCGAAGACAGAAGACGAAATACATTACGGCGGAGGAACTCAAAGCCGCGGCACCGGGTCTTCAC
ATTCCGGATGCTTTCACGCCCATACTGGATATGACGGGGCCCGAGGGCAAGCTCATCACCTCGGCCAGCGGTGTC
ATGACCCCTCGTGGAGGCGTGGCGGAGCCGGACGAGGTGGTCGAGGCCAGGAAGCTGGTGAAACGTGCGCAGGCA
GAGTTGATGGCCTTTTCAGAGGAATGGAGAAGCCTCGAAGAGCGCAAGTCGTGGCTGAGACTGGAGCTCAGGGAG
AGGGAACAAGAGGTGGACGATCTGCGGTCTGAGCTGGGTCGGCTGCAGAATCTGTCCGCCATCGTTGCCGAGCAG
CTTACGCAGGCCTCGGACTGGAATCAGGTGGTTGCCTGCCTCGAAAAGGCGGTGAGCCTGGGAAATGTGATGCCA
GAGGTGGCAGACGTCGCTGTCGCTGCGATGCATCCGTTCCTCAAGGCCGCAGACTGGAAGCCGCTGGAAGAGCCC
GATCGATTCGCGTCCGACCTGAAGCGACTGTCCAGCCTTTTTACGAAATCGGAGACCGGTGGCGATGGCAAGACC
ATCAACAAGTGGGATTCGCGCGCGGCCAAGGCGGACGGCGTCTATCGACAGCATCGCAAAGCGACGACGTCCTAC
GAAAGCATGATGTACAAGTTGTGGCTGCCTCGGGTATTGGCGGCGATCCGAGAATGGGATGCCCTGACTCCGGGG
CCGATGGTCAGCGTGGTCGAGGCCTGGGACGACATCATGCCCCCCTTCGTACGGACACAAGTCATGGAGAGCATT
GGCCGCAAGTTGGAGTCGGCCCTGGCGGATTGGAACCCGAGGAAGAAGAAGCAGTTACCTCATACCTGGCTCTTC
CCCTGGCTCCCGCTGCTGCCGGCGTATCACCTGGATGTCAGGGGTACAGGACTGGTAGCAGATGTGAAGAGGAAG
CTGCGGCAGCTGGTGGATGGATGGGATTTTGAGCGAGGCATCGTGCCCGGGCTGCAGCAGTGGCAAGAGGTGCTG
GGCAACGAATGGCGGCCGCTTATGATGTCGCACGTGCTGCCATCGATGAGCCGATGTCTACGGGCCAGATTTCGT
GTCGATCCGGCTGATCAGGAGCCGTATCTGCCGGTGCTGGTGGGGGCGCTCGAGTGGCAAGCGATGCTAGGCGAC
GCGGTCATGGGCGAGATGGTTGTGCAGACGGTGCTGCCCATGTGGAACGCGAAGCTACAGGCCTGGCTGGCGCTG
GAGGAGGCGGACCTGGCCGAGGTAGCCGACTGGTACGGGTGGTGGCGGGGGATGATGCTGAAGAAGCTGGCTGGG
ACGCAGATGGTGAGCGAGGAGCTGGACAAGGGCTTGCGCATCATGATGATGCTGTAG
Transcript >Ophcf2|00647
ATGGACGGATCTCCGCGCCTCGCCTTTGATCCGTCACGTGTCACCAAAGCTTCCGCGACAGACTATTCTTCGTCC
GAATCCGAATCCGAGGACGAACATGTCCTGCCTGGTGTTGACAACGACTTTGGCGATTACAACCCTCGGAAAAAG
CGTCGCATCGGGGTAAACGGCAAGGAAAAGGCGGCTCTAGGGATATTTGGTTCGGATAGCGACGACGATCGTCCC
GGCCAGCGATGGAAGGGCAAGACGTTGAGGCGCAAGGGAGTGAGCTTCGTTTCCACCGACGCGCAGGGTGTCCAA
GGTGGCGAAGAAAGCGACATCCTCGAGAGTCATCCGGAATCAAGCGACGGAAATCCGGATAGTGACTACGATGAC
GATGAAGCCGAACCAGGCGCTGGCTTGGGGTTCAGCAAGACGGCACGGACGGCAAATGGCTCGCGAAAGCAGGAG
CAGAATTCGCCTGCTGCTGAGGCAAAGCCGATACTCGGAAAAAAGGGCATCGTCTTTCGCGCATCGGTGCCGCCA
GCGAACGCGCCGGTTCTCACACAGAAAGCCATGGATAGCACACCTCCTATCCGTAACAAGCCTCAGCCAAGCGCG
TTCGGGAGTAAGGGCAAGATTAACGCCAAATCATTCGGCGCCCGCATGATGGCCAAGATGGGCTACGTCGACGGC
ATGGGCCTCGGCAAGGAGGGACAGGGAAGAAATGTCGTTATCGAGGCGAACCTGCGACCTCAAGGTATTGGTTTG
GGGGCGGTGAAGGAGAAGACGGAGAGTGAACGAAAAGAGGAGAAACGACAGGCCCAGTTGCGAGGCGAGGTCGTC
ATCGACTCGGACGAGGAAGAGAAGCGACGGAAAAAGGCCAAGAAGATGTCTCGGGGCATTGCTGGCAGAAGCGCT
TCCGGTACGCCTCGAAGACAGAAGACGAAATACATTACGGCGGAGGAACTCAAAGCCGCGGCACCGGGTCTTCAC
ATTCCGGATGCTTTCACGCCCATACTGGATATGACGGGGCCCGAGGGCAAGCTCATCACCTCGGCCAGCGGTGTC
ATGACCCCTCGTGGAGGCGTGGCGGAGCCGGACGAGGTGGTCGAGGCCAGGAAGCTGGTGAAACGTGCGCAGGCA
GAGTTGATGGCCTTTTCAGAGGAATGGAGAAGCCTCGAAGAGCGCAAGTCGTGGCTGAGACTGGAGCTCAGGGAG
AGGGAACAAGAGGTGGACGATCTGCGGTCTGAGCTGGGTCGGCTGCAGAATCTGTCCGCCATCGTTGCCGAGCAG
CTTACGCAGGCCTCGGACTGGAATCAGGTGGTTGCCTGCCTCGAAAAGGCGGTGAGCCTGGGAAATGTGATGCCA
GAGGTGGCAGACGTCGCTGTCGCTGCGATGCATCCGTTCCTCAAGGCCGCAGACTGGAAGCCGCTGGAAGAGCCC
GATCGATTCGCGTCCGACCTGAAGCGACTGTCCAGCCTTTTTACGAAATCGGAGACCGGTGGCGATGGCAAGACC
ATCAACAAGTGGGATTCGCGCGCGGCCAAGGCGGACGGCGTCTATCGACAGCATCGCAAAGCGACGACGTCCTAC
GAAAGCATGATGTACAAGTTGTGGCTGCCTCGGGTATTGGCGGCGATCCGAGAATGGGATGCCCTGACTCCGGGG
CCGATGGTCAGCGTGGTCGAGGCCTGGGACGACATCATGCCCCCCTTCGTACGGACACAAGTCATGGAGAGCATT
GGCCGCAAGTTGGAGTCGGCCCTGGCGGATTGGAACCCGAGGAAGAAGAAGCAGTTACCTCATACCTGGCTCTTC
CCCTGGCTCCCGCTGCTGCCGGCGTATCACCTGGATGTCAGGGGTACAGGACTGGTAGCAGATGTGAAGAGGAAG
CTGCGGCAGCTGGTGGATGGATGGGATTTTGAGCGAGGCATCGTGCCCGGGCTGCAGCAGTGGCAAGAGGTGCTG
GGCAACGAATGGCGGCCGCTTATGATGTCGCACGTGCTGCCATCGATGAGCCGATGTCTACGGGCCAGATTTCGT
GTCGATCCGGCTGATCAGGAGCCGTATCTGCCGGTGCTGGTGGGGGCGCTCGAGTGGCAAGCGATGCTAGGCGAC
GCGGTCATGGGCGAGATGGTTGTGCAGACGGTGCTGCCCATGTGGAACGCGAAGCTACAGGCCTGGCTGGCGCTG
GAGGAGGCGGACCTGGCCGAGGTAGCCGACTGGTACGGGTGGTGGCGGGGGATGATGCTGAAGAAGCTGGCTGGG
ACGCAGATGGTGAGCGAGGAGCTGGACAAGGGCTTGCGCATCATGATGATGCTGTAG
Gene >Ophcf2|00647
ATGGACGGATCTCCGCGCCTCGCCTTTGATCCGTCACGTGTCACCAAAGCTTCCGCGACAGACTATTCTTCGTCC
GAATCCGAATCCGAGGACGAACATGTCCTGCCTGGTGTTGACAACGACTTTGGCGATTACAACCCTCGGAAAAAG
CGTCGCATCGGGGTAAACGGCAAGGAAAAGGCGGCTCTAGGGATATTTGGTTCGGATAGCGACGACGATCGTCCC
GGCCAGCGATGGAAGGGCAAGACGTTGAGGCGCAAGGGAGTGAGCTTCGTTTCCACCGACGCGCAGGGTGTCCAA
GGTGGCGAAGAAAGCGACATCCTCGAGAGTCATCCGGAATCAAGCGACGGAAATCCGGATAGTGACTACGATGAC
GATGAAGCCGAACCAGGCGCTGGCTTGGGGTTCAGCAAGACGGCACGGACGGCAAATGGCTCGCGAAAGCAGGAG
CAGAATTCGCCTGCTGCTGAGGCAAAGCCGATACTCGGAAAAAAGGGCATCGTCTTTCGCGCATCGGTGCCGCCA
GCGAACGCGCCGGTTCTCACACAGAAAGCCATGGATAGCACACCTCCTATCCGTAACAAGCCTCAGCCAAGCGCG
TTCGGGAGTAAGGGCAAGATTAACGCCAAATCATTCGGCGCCCGCATGATGGCCAAGATGGGCTACGTCGACGGC
ATGGGCCTCGGCAAGGAGGGACAGGGAAGAAATGTCGTTATCGAGGCGAACCTGCGACCTCAAGGTATTGGTTTG
GGGGCGGTGAAGGAGAAGACGGAGAGTGAACGAAAAGAGGAGAAACGACAGGCCCAGTTGCGAGGCGAGGTCGTC
ATCGACTCGGACGAGGAAGAGAAGCGACGGAAAAAGGCCAAGAAGATGTCTCGGGGCATTGCTGGCAGAAGCGCT
TCCGGTACGCCTCGAAGACAGAAGACGAAATACATTACGGCGGAGGAACTCAAAGCCGCGGCACCGGGTCTTCAC
ATTCCGGATGCTTTCACGCCCATACTGGATATGACGGGGCCCGAGGGCAAGCTCATCACCTCGGCCAGCGGTGTC
ATGACCCCTCGTGGAGGCGTGGCGGAGCCGGACGAGGTGGTCGAGGCCAGGAAGCTGGTGAAACGTGCGCAGGCA
GAGTTGATGGCCTTTTCAGAGGAATGGAGAAGCCTCGAAGAGCGCAAGTCGTGGCTGAGACTGGAGCTCAGGGAG
AGGGAACAAGAGGTGGACGATCTGCGGTCTGAGCTGGGTCGGCTGCAGAATCTGTCCGCCATCGTTGCCGAGCAG
CTTACGCAGGCCTCGGACTGGAATCAGGTGGTTGCCTGCCTCGAAAAGGCGGTGAGCCTGGGAAATGTGATGCCA
GAGGTGGCAGACGTCGCTGTCGCTGCGATGCATCCGTTCCTCAAGGCCGCAGACTGGAAGCCGCTGGAAGAGCCC
GATCGATTCGCGTCCGACCTGAAGCGACTGTCCAGCCTTTTTACGAAATCGGAGACCGGTGGCGATGGCAAGACC
ATCAACAAGTGGGATTCGCGCGCGGCCAAGGCGGACGGCGTCTATCGACAGCATCGCAAAGCGACGACGTCCTAC
GAAAGCATGATGTACAAGTTGTGGCTGCCTCGGGTATTGGCGGCGATCCGAGAATGGGATGCCCTGACTCCGGGG
CCGATGGTCAGCGTGGTCGAGGCCTGGGACGACATCATGCCCCCCTTCGTACGGACACAAGTCATGGAGAGCATT
GGCCGCAAGTTGGAGTCGGCCCTGGCGGATTGGAACCCGAGGAAGAAGAAGCAGTTACCTCATACCTGGCTCTTC
CCCTGGCTCCCGCTGCTGCCGGCGTATCACCTGGATGTCAGGGGTACAGGACTGGTAGCAGATGTGAAGAGGAAG
CTGCGGCAGCTGGTGGATGGATGGGATTTTGAGCGAGGCATCGTGCCCGGGCTGCAGCAGTGGCAAGAGGTGCTG
GGCAACGAATGGCGGCCGCTTATGATGTCGCACGTGCTGCCATCGATGAGCCGATGTCTACGGGCCAGATTTCGT
GTCGATCCGGCTGATCAGGAGCCGTATCTGCCGGTGCTGGTGGGGGCGCTCGAGTGGCAAGCGATGCTAGGCGAC
GCGGTCATGGGCGAGATGGTTGTGCAGACGGTGCTGCCCATGTGGAACGCGAAGCTACAGGCCTGGCTGGCGCTG
GAGGAGGCGGACCTGGCCGAGGTAGCCGACTGGTACGGGTGGTGGCGGGGGATGATGCTGAAGAAGCTGGCTGGG
ACGCAGATGGTGAGCGAGGAGCTGGACAAGGGCTTGCGCATCATGATGATGCTGTAG

© 2023 - Robin Ohm - Utrecht University - The Netherlands

Built with Python Django and Wagtail