Fungal Genomics

at Utrecht University

General Properties

Protein IDOphcf2|00644
Gene name
Locationscaffold_01:2489653..2499361
Strand-
Gene length (bp)9708
Transcript length (bp)9654
Coding sequence length (bp)9654
Protein length (aa) 3218

Overview

Your browser does not support drawing a protein figure.

PFAM Domains

PFAM Domain ID Short name Long name E-value Start End
PF06650 SHR-BD SHR-binding domain of vacuolar-sorting associated protein 13 1.0E-91 2281 2563
PF16910 VPS13_mid_rpt Repeating coiled region of VPS13 4.2E-90 592 828
PF16908 VPS13 Vacuolar sorting-associated protein 13, N-terminal 4.7E-85 139 378
PF16909 VPS13_C Vacuolar-sorting-associated 13 protein C-terminal 4.6E-70 2813 2988
PF12624 Chorein_N N-terminal region of Chorein or VPS13 2.2E-39 2 115

GO

(None)

Deeploc

[Help with interpreting the results of Deeploc 2.0]
Localizations Signals Cytoplasm Nucleus Extracellular Cell membrane Mitochondrion Plastid Endoplasmic reticulum Lysosome vacuole Golgi apparatus Peroxisome
Cytoplasm|Lysosome/Vacuole 0.4966 0.2874 0.0683 0.1615 0.6299 0.0823 0.4066 0.6738 0.4997 0.0124

SignalP

(None)

Transmembrane Domains

(None)

Transcription Factor Class

(None)

CAZymes

(None)

Secondary Metabolism

(None)

Expression data

Analysis 1: Expression analysis during behavioral modification. Published in: Will et al., G3, 2020

Expression values

Label Description Expression (RPKM) Confidence interval (low) Confidence interval (high)
Fungus Fungus in pure culture 31.46 15.95 46.96
Alive In ants, during behavior modification 21.64 11.31 31.97
Dead In ants, recently dead 23.43 12.31 34.55

Differential expression

Label1 Label2 Q-value Significant difference
Alive Fungus 0.076766 no
Alive Dead 0.711614 no
Dead Fungus 0.179566 no

Orthologs

Orthofinder run ID4
Orthogroup2095
Change Orthofinder run
Species Protein ID
Ophiocordyceps australis 1348a (Ghana) OphauG2|3932
Ophiocordyceps australis map64 (Brazil) OphauB2|7982
Ophiocordyceps camponoti-floridani Ophcf2|00644 (this protein)
Ophiocordyceps camponoti-rufipedis Ophun1|2027
Ophiocordyceps kimflemingae Ophio5|4142
Ophiocordyceps subramaniannii Hirsu2|2462

Sequences

Type of sequenceSequence
Locus Download genbank file of locus Download genbank file of locus (reverse complement)
The gene with 5 kb flanks (if sufficient flanking sequence is available). For use in cloning design programs. NOTE: features (genes or exons) that are only partially contained within the sequence are completely excluded.
Protein >Ophcf2|00644
MLEGLAAGLLNRFLGMYVQNFDPTQLKVGIWSGDVKLRNLELRREALDQLKLPINVVEGHLGQLTLIIPWSNLRG
APVKVFVEDVFLLASPKEEAEYDQKEEEQRSQRLKMEKLDSAELLKEKNREGMSPEEQQKNQSFTQSLVTKIVDN
LQITVKKIHIRYEDSISAPGHPFALGLTLEEFSAVSTDGDWKPTFIQNSTVITNKLATLGALAVYWNTDTHLMGS
GREAALPPDEAMSHEDMVTKFRSLIDTTASSDHQFILKPVSGQAKIELNKSGDVVAPKFKVNLLFEEIGLVLDDH
QYRDALMMADLFHYFIRHQEYRALKPKGVRPSQDPRAWFRFAGKAVLGNIHERNRKWSWDYFRERRDDRIRYIEL
FKKKKEQQQLSPDEEEDIVTLEWKLGYEDLRFWRSLARNQLKKENAEALKRRAQQPEQQGWMSWIWGSKPQGKIE
KNEENTQMTEEQRKELYDMIDWDEKTALAEAIDVPREAVKLCIEACLGTGSFTLRQGSHGKAPRDLLGLYFDVFK
AKALQRKDSMLANVSLGGLRVEDGTTPDSLYPEIVRVKDAPGTKQRKRLSLAELEKSSDEPFFQFEVEQNPIERE
GDIAVMGSLKPLEVVWNPNFVVGIVDFFRPPERHMESITALMETAGATVEGIREQTRAGLEFALEEHKTINAELS
LQAPLIIVPVSITAGESTCVIVDAGHIHVNSQLVDQETMKEIQAKQRQTYSEEDFKRLESVMYDKFIVKLTSTQV
LIGPSIEKTKAQLTRRSEGSQLHVVEKINVDFVVETSILPKAPNLTKFRVSGHMPMLHASVSDSKYKNLMKIIDV
AIPKLGGESRQDEVPALKADEGGHPRVAPPQEQTRQPSRPRLASSGSNRSPGRRSQRENRQSAGFPFLQPPSAVV
LDDMDDDQDDFEDASDGADGEQLKIQQRSFEFNFKVDTLKGSLYRSDPDRTKPDALLVELVAERFDLAFYTRLYD
MSAEVSLGAVSVDDFVDNPPAEFKSIVSSGDSDDLQEGRSLVHVKYMDVKPQSPEFMPVYEGVKTNISASVLTIN
LVVTRKTLLTLLDFILVTFAGGNNDQEQSRTAVTDGQGAGHEETATEPAKQNADSGSIRVKVDLKGIRLILNNDG
IRLATLSLTEADAGIFLRGNTMRIFAKLGDLSLVDDVNLGVSRDSNLRRLVTIQGDELADFRYETFDADNKQAYP
GHDSAIFLRAGSVKVNFVEEPFRKIIDFLVKFGRMQALYNAARQAAVTRANQMQQSPSRFKFDVVIKTPIVVFPR
LMVSESPERDVVTAYLGEIYAQNEFAPLDDGEASRIAMKISTGIRKIRLTSDFNYDNDRSEELEMIDQVDLGLSI
TYAEHKHGVMRPDTEIEASMSDIKLRLTQHQLKFLLEISKAVPAAFAGDGSTGDEDAAQLVDEETLRRARTASAD
HGIGPDQHAVDLGPELKSPTDTWTQLDLVFRVDTIGLELIMAPLDEPVGDLAASSLSRFSLDETKVKTRMMSDGS
LEAELLIRSLTIYDSRPKGVNKFRRIMSSSNKESQQLMASVTMSGGKESSMIAMATIDSPRVIFALDYLFALQAF
ATEGLKVEDSSPLDDVSTDESPEGSEDADSLRVSSTKPGPSQATSPRRSESSSGEPQKRQGEASMSLALRVNLVD
AQVILIANPLRSNSEAIVLGIRQVLLSQQNALTFQVSEMGMFLCVMDRFETSRLRIIDDFSIQLNMDNSQPFTAS
YHVDVEPLIVRLSLRDILLVLQIVAKASELSESGKEPVKETPAEQKAKQLRGASCKSKAPSGRALSTAAQTKANQ
AVVTKGAAATKPRGRSTHEELSATLQGMRIVLIGDLHELPIVDVGVKEFTATAENWSSNLKAEAAIHTYTNVYNF
SKSSWEPLIEPWQVGLGVARDSTTGVLSVDVASAKTLDITITTATIAVASKSLDFLTTQEDVLDKPRWSDAPYRI
RNHTGFVITMHSRSPSSEESIDLRLDDGEEAPWTFEEWEKMRENILTKGAAQNDVGIKLEGSGFDTVKNVRVNRE
GEYLYSLRPKTDNVTHRLCVDVRLGSDNVKDVTLRSPLLVENATEIPVELGIYDASEGHLLKIEKIAPGDSRPAP
VGAAYEKKMIVRPDSGFGYQWSRDQLWWRDLLKRPTKQLVCTGDTGDSFYFQVHADFDKTNPLTKAYPSMKIKLS
APVTLENLLPYDFKYRIYDRNTKKDWSNFLRKGGVSPVHMVELSHLLLLSVDMQDTIFKPSDFSIINSGSNDDFR
KEKRLLVRDEQGLTLHLSLHYFKVPKSGGAFKISVYSPYVVLNKTGLDMGIRAKSFLQQAKAAAGQFPVAQTGSQ
DRPKALPFMFSFGNDEHQNRALLKVDESEWSKPQSFDAVGSTSEVVLNSSTSKHREIHLGITVKSGDGKYKMTRV
VTLAPRFVLVNKLGEEVLVRESGSSNHMTIRSGVLHPLHFMQKSAVKQLCLRFPGVDNHWTSPFNIADLGTTHVK
MARAGQRQRLVRVEILTEESTIFLHMSVEGKHWPFSMRNESDTEFSFYQANPNVDEDDDEDRSGWKPVRYRLPPR
SVMPYAWDFPAAKFREVVISTCGKERHVKLAEMGNQIPMKFAGPGGQQKIIDINVAADGPMQTLILSNFRASRSM
FKPAAVSRTNTGPEAFEVKDQGTGATMLAQLKLSGIGVSLINAHLKELAYVTLREVQLRLSDSPLIQTMSLAVKW
IQIDNQLYGGIFPIVLYPSVVPKRANEVEAHPSLHAMVSRVKDDSYGVLYIKYATVLLQQMTVDLDEDFVFALLD
FSNVPGASWTAVEGPGSGRLCDEDLDIPEPSQQQSGQDMYFEVLNIQPMQIDLSFVRTERVNAEDKTSTRNPIMF
FLNVMTMAIGNVNDAPVRFNALMLDNVRVSRAVLVQNVSSHYSQEVMYQIHKILGSADFLGNPVGLFNNISSGVT
DIFYEPYQGLILSDRPEEFGIGIARGAVSFAKKTVYGFSDSFSKFTGSLGKGLAAASLDKQFQDRRRITRARNRP
KHALYGVAAGANSLLTSVASGVGGLARKPLEGAEQEGALGFFKGVGKGVLGLATKPAVGVLDMASNVSEGIRNTT
TVFDGSELERTRLPRFMANDGIVRPYGAREALGQFWLKQVDNGKYFDEQYVGHLELPREDMVVMVTYARILLIRS
RRLTSEWDVKLKDVQTVAKERTGVSLTLRGGTNGPFIPVGGGSERGYLYRMIGVAAEEFNRRFRGAE*
Coding >Ophcf2|00644
ATGCTCGAGGGGCTCGCGGCCGGCCTGCTCAACCGCTTCTTGGGCATGTACGTCCAAAACTTCGATCCCACCCAG
CTCAAGGTCGGCATCTGGTCCGGTGACGTCAAGCTCCGCAACCTCGAGCTCCGGCGTGAGGCCCTCGATCAGCTC
AAGCTGCCCATCAACGTCGTCGAGGGCCATCTCGGCCAGCTGACGCTCATCATCCCGTGGTCCAACCTGCGAGGC
GCCCCGGTCAAGGTCTTCGTCGAAGACGTCTTCTTACTCGCTAGCCCAAAGGAAGAGGCCGAATATGATCAGAAG
GAGGAGGAGCAACGAAGCCAGCGGCTCAAGATGGAGAAGCTTGACAGCGCCGAGCTGCTCAAGGAGAAGAATCGA
GAGGGCATGAGTCCCGAAGAGCAGCAAAAGAATCAGAGCTTCACGCAGAGTCTCGTCACCAAGATCGTCGACAAC
CTGCAAATCACCGTCAAGAAGATCCACATCCGATATGAAGATTCCATTTCCGCCCCCGGCCATCCCTTCGCCCTC
GGCCTCACGCTCGAAGAGTTCTCGGCGGTCAGCACCGACGGCGACTGGAAGCCGACTTTTATACAAAACTCGACC
GTCATCACCAACAAGCTGGCCACGCTCGGAGCCTTGGCCGTGTACTGGAACACAGACACTCATCTCATGGGCAGT
GGGCGCGAAGCTGCGCTGCCGCCTGACGAGGCCATGTCCCACGAAGACATGGTGACCAAGTTTCGCTCCCTCATC
GATACGACCGCCTCATCGGACCATCAGTTCATTCTAAAACCCGTCAGCGGCCAGGCCAAGATCGAGCTCAACAAG
TCGGGCGATGTTGTGGCTCCTAAGTTCAAGGTTAACCTGTTGTTCGAGGAGATCGGTCTCGTGCTCGACGACCAC
CAATACCGCGATGCCCTGATGATGGCCGATCTGTTCCATTACTTCATCCGCCACCAGGAGTACAGAGCGCTGAAG
CCCAAGGGCGTTCGACCGAGCCAGGACCCCCGAGCTTGGTTTCGATTCGCAGGCAAGGCCGTGCTCGGCAACATC
CACGAGCGGAACCGCAAGTGGTCCTGGGACTATTTTAGGGAGCGGCGCGACGATCGCATCCGCTACATAGAACTC
TTCAAGAAGAAGAAGGAGCAGCAGCAGCTGTCGCCGGACGAAGAAGAGGATATCGTGACTCTCGAGTGGAAGCTG
GGATACGAAGACTTGCGCTTCTGGCGTTCCCTGGCCCGCAACCAGCTTAAAAAAGAAAACGCGGAGGCTTTGAAA
AGACGAGCCCAGCAGCCTGAGCAGCAGGGCTGGATGTCATGGATCTGGGGCTCGAAGCCGCAAGGAAAGATTGAG
AAGAACGAGGAAAACACTCAGATGACCGAGGAGCAGCGCAAGGAGCTGTACGACATGATTGACTGGGACGAGAAG
ACGGCACTGGCGGAGGCCATCGACGTCCCGCGCGAGGCCGTCAAGCTCTGCATCGAGGCCTGTCTCGGCACCGGG
AGCTTCACCCTCAGACAGGGCAGTCACGGAAAGGCTCCGAGAGACCTGCTCGGGTTATACTTTGACGTCTTCAAA
GCAAAGGCCCTGCAGCGCAAGGACTCGATGCTCGCCAACGTCAGTCTCGGGGGTTTAAGGGTCGAGGACGGCACG
ACACCAGACAGCCTTTACCCCGAGATTGTACGGGTCAAAGACGCTCCCGGGACGAAGCAGCGCAAGAGACTGTCC
CTAGCGGAGCTAGAGAAGAGCAGCGATGAGCCGTTCTTCCAGTTCGAGGTGGAGCAGAACCCGATCGAGCGCGAG
GGCGACATCGCCGTCATGGGCAGTCTGAAGCCCCTCGAGGTCGTGTGGAATCCCAACTTCGTCGTTGGAATCGTT
GACTTCTTCAGACCGCCCGAGAGGCACATGGAGTCCATCACGGCCCTCATGGAAACGGCCGGCGCCACCGTCGAG
GGCATCAGGGAGCAGACACGCGCCGGCCTCGAGTTCGCCCTCGAGGAGCACAAGACCATCAACGCCGAGCTGAGC
CTGCAGGCGCCGCTCATCATCGTACCAGTCAGCATCACGGCCGGGGAGTCTACGTGCGTCATCGTCGACGCTGGC
CACATCCACGTCAACAGCCAGCTGGTAGACCAGGAGACCATGAAGGAGATCCAGGCCAAGCAGCGGCAGACTTAC
AGCGAGGAGGACTTTAAGAGGCTCGAGTCGGTCATGTACGACAAATTCATCGTCAAGCTCACCTCTACCCAGGTC
CTCATCGGGCCTTCGATCGAGAAGACCAAGGCGCAGCTCACGAGGAGGAGCGAAGGCTCCCAGCTGCACGTCGTC
GAGAAGATCAACGTCGACTTTGTCGTGGAGACGTCGATCCTGCCCAAGGCCCCTAACCTGACCAAGTTCAGGGTG
TCCGGCCACATGCCAATGCTCCACGCCTCGGTTTCGGACTCCAAGTACAAGAACCTGATGAAGATCATCGATGTG
GCCATTCCCAAGCTCGGAGGTGAGAGTCGGCAGGACGAAGTGCCGGCGCTCAAGGCCGACGAGGGCGGGCATCCC
CGAGTTGCCCCGCCGCAAGAGCAGACTCGACAGCCTTCGCGACCCCGGCTCGCTAGCAGCGGCTCGAATAGGTCT
CCTGGGCGGAGGTCGCAGCGGGAGAATAGGCAGTCGGCCGGGTTTCCCTTTCTGCAGCCGCCCAGCGCCGTCGTG
CTCGACGACATGGATGATGATCAGGACGACTTCGAGGACGCCTCAGACGGTGCAGACGGGGAACAGCTCAAGATT
CAGCAGCGGAGCTTCGAGTTCAACTTCAAGGTCGATACTCTCAAAGGCTCGCTCTACCGTAGCGATCCGGACCGC
ACCAAGCCCGACGCTCTGTTGGTCGAGCTCGTGGCCGAGCGCTTCGACCTTGCCTTTTACACGAGGCTGTACGAC
ATGTCTGCCGAGGTGTCTCTCGGGGCTGTATCTGTGGACGACTTCGTCGACAATCCCCCTGCAGAGTTCAAGTCC
ATCGTCTCGTCCGGTGACAGTGATGACCTCCAGGAAGGCCGGAGTCTGGTCCACGTCAAGTACATGGATGTCAAG
CCACAGTCGCCCGAGTTTATGCCCGTTTACGAGGGAGTCAAGACGAACATCAGTGCCTCGGTGTTAACCATCAAC
CTCGTCGTGACGAGGAAGACGCTACTGACGCTCCTCGACTTCATTCTCGTCACCTTTGCCGGAGGCAACAACGAC
CAGGAACAAAGCCGAACGGCCGTCACCGATGGTCAAGGCGCCGGACACGAAGAGACGGCTACGGAGCCGGCCAAG
CAAAACGCCGACTCGGGTTCCATCAGAGTCAAGGTGGATCTGAAGGGCATCAGGCTCATCCTCAACAACGACGGC
ATAAGGTTGGCGACGCTGTCGCTCACGGAGGCCGACGCCGGCATATTCCTGCGCGGAAACACGATGCGAATATTT
GCAAAGCTCGGAGATTTGTCTCTCGTCGACGACGTCAACCTGGGCGTCTCCAGGGACTCCAACCTGCGGAGACTC
GTCACCATTCAAGGCGACGAACTCGCCGATTTCCGCTACGAGACGTTTGACGCCGACAACAAGCAGGCGTATCCG
GGCCATGACAGCGCCATCTTCCTGCGGGCCGGTTCGGTCAAGGTAAACTTCGTCGAGGAGCCGTTCCGCAAGATC
ATCGACTTCCTCGTCAAGTTCGGCAGGATGCAAGCCCTTTACAACGCTGCACGACAGGCCGCCGTGACACGGGCC
AACCAGATGCAGCAGAGTCCCAGCAGGTTCAAGTTTGACGTCGTCATCAAGACGCCCATCGTCGTCTTCCCGCGC
TTGATGGTCTCGGAGTCTCCTGAACGCGACGTCGTGACGGCATACCTGGGCGAGATCTATGCGCAGAACGAGTTT
GCGCCTCTCGATGATGGCGAGGCTTCTCGGATCGCCATGAAGATATCCACGGGCATCAGGAAGATCCGGCTTACG
TCCGACTTCAACTACGACAACGACAGATCGGAAGAGCTAGAGATGATAGATCAGGTTGACCTTGGGCTGAGCATC
ACCTATGCCGAGCACAAGCATGGCGTCATGCGCCCAGACACGGAGATCGAGGCGTCCATGTCGGACATCAAGCTC
AGGCTCACGCAGCATCAGCTCAAGTTCCTGCTGGAGATCTCCAAAGCAGTTCCTGCTGCCTTTGCTGGCGACGGC
AGCACCGGCGACGAGGACGCGGCTCAGCTCGTCGACGAGGAGACGCTGCGGCGCGCCAGAACGGCGTCGGCAGAC
CATGGTATCGGCCCTGACCAGCACGCCGTCGACCTCGGGCCCGAGTTGAAGTCGCCTACGGATACGTGGACCCAG
CTCGACTTGGTGTTCCGAGTCGACACCATCGGTCTCGAACTCATCATGGCACCGCTGGACGAGCCCGTGGGCGAC
TTGGCCGCGTCCAGCCTGTCTCGCTTCTCGCTCGACGAAACCAAGGTGAAGACGCGGATGATGTCGGATGGCTCG
CTGGAAGCCGAGTTGCTCATTCGCTCCTTGACCATCTACGACAGCCGTCCGAAAGGAGTCAACAAGTTCCGTCGC
ATCATGAGCTCTTCAAACAAAGAGTCCCAGCAACTCATGGCGAGCGTCACCATGTCGGGCGGCAAGGAGAGCAGC
ATGATCGCCATGGCGACCATCGACAGCCCTCGCGTCATCTTCGCGCTCGACTACCTCTTCGCTCTCCAGGCGTTT
GCCACCGAAGGCCTCAAGGTGGAAGATTCCAGCCCGCTGGACGATGTCAGCACCGACGAGTCACCAGAAGGCTCG
GAAGATGCCGACTCGTTGCGAGTGTCGTCCACTAAGCCTGGTCCGTCTCAGGCGACGTCTCCGCGACGCAGCGAA
TCCAGCTCCGGCGAGCCGCAGAAGCGTCAAGGCGAGGCTTCGATGAGCTTGGCCTTGCGAGTCAACCTCGTCGAC
GCGCAGGTCATACTCATCGCCAACCCGCTGAGGTCCAATTCCGAAGCCATCGTCCTGGGCATCCGACAGGTGCTT
CTATCGCAACAGAACGCACTCACGTTCCAGGTCTCCGAGATGGGCATGTTTCTATGCGTCATGGACAGGTTCGAG
ACGTCGCGCCTCAGAATCATCGACGACTTTTCGATACAGTTGAACATGGACAACTCGCAGCCATTCACGGCCAGC
TATCACGTCGATGTCGAGCCTCTCATCGTTCGACTCTCCCTGAGAGATATTCTCCTCGTGCTCCAGATCGTCGCC
AAAGCCAGCGAGCTCTCGGAAAGCGGGAAAGAGCCGGTCAAAGAGACGCCGGCGGAGCAAAAGGCGAAGCAGCTC
AGAGGCGCCAGCTGCAAGTCAAAGGCCCCCAGCGGCCGCGCCCTGTCGACGGCGGCTCAGACCAAGGCCAACCAG
GCCGTTGTCACCAAAGGAGCCGCGGCGACAAAGCCACGCGGCAGAAGCACGCATGAGGAGCTCTCTGCGACGCTT
CAGGGCATGCGGATCGTGCTGATCGGAGACCTGCACGAGCTGCCCATCGTCGACGTCGGAGTCAAGGAGTTTACG
GCCACGGCAGAGAACTGGTCGTCGAATCTGAAAGCCGAGGCGGCCATACACACGTACACGAACGTCTACAACTTT
TCGAAATCCAGCTGGGAGCCCCTGATCGAACCATGGCAGGTCGGCCTGGGCGTGGCCAGAGACTCGACCACGGGC
GTACTGTCGGTCGACGTGGCCTCGGCCAAGACGCTGGATATCACGATCACGACGGCGACCATCGCAGTGGCTTCC
AAGTCGCTCGACTTTCTCACGACGCAGGAAGACGTCTTGGACAAACCAAGGTGGAGCGACGCGCCTTACCGCATC
AGAAACCACACTGGATTCGTCATCACGATGCACTCGCGAAGCCCAAGCAGCGAAGAGTCCATCGACCTGCGGCTC
GACGACGGAGAGGAGGCACCGTGGACCTTTGAAGAATGGGAGAAGATGCGCGAGAACATCCTGACCAAAGGCGCC
GCCCAGAATGACGTGGGCATCAAGTTGGAGGGCAGCGGCTTCGACACCGTGAAGAACGTGCGGGTGAACCGAGAG
GGCGAGTATCTCTACAGCCTGCGGCCCAAGACGGACAACGTGACGCATCGGCTGTGCGTCGACGTACGTCTCGGG
TCTGACAATGTCAAGGACGTGACGCTACGATCTCCGCTGCTCGTCGAGAACGCGACGGAGATCCCGGTCGAGCTC
GGCATCTACGACGCTTCAGAGGGTCACCTTCTCAAGATCGAGAAGATCGCTCCCGGGGACTCGCGTCCGGCCCCG
GTCGGCGCCGCGTACGAAAAGAAGATGATTGTGCGTCCGGACAGCGGCTTCGGCTATCAGTGGAGCAGAGACCAG
CTCTGGTGGAGGGATCTGCTCAAGCGACCGACCAAGCAGCTCGTCTGCACGGGGGATACCGGCGATTCGTTCTAC
TTTCAGGTCCACGCGGACTTTGACAAGACCAACCCATTGACCAAGGCATATCCGTCGATGAAGATCAAGCTCTCG
GCTCCGGTGACGCTGGAAAACCTGTTGCCGTACGACTTCAAGTACAGGATCTACGACAGGAACACCAAGAAGGAC
TGGTCCAACTTTCTGAGAAAGGGCGGCGTGAGCCCCGTCCACATGGTGGAGCTCTCTCATCTCCTACTCCTGAGC
GTCGATATGCAGGACACCATCTTCAAGCCGAGCGACTTCTCCATCATCAACTCCGGAAGCAACGACGACTTCCGC
AAGGAGAAGCGGCTCCTGGTCAGGGACGAGCAAGGCCTGACGCTGCACCTCAGCCTCCACTACTTCAAAGTGCCC
AAGAGCGGCGGCGCGTTCAAGATCAGCGTGTACAGCCCCTACGTCGTGTTGAACAAGACGGGTCTCGACATGGGG
ATCCGCGCCAAGAGCTTCCTACAGCAGGCCAAGGCGGCGGCCGGTCAGTTCCCCGTGGCGCAGACGGGAAGCCAA
GATAGGCCGAAGGCGCTGCCGTTCATGTTCTCGTTCGGAAACGACGAGCATCAGAACCGGGCGCTGCTCAAGGTG
GACGAGTCGGAGTGGAGCAAGCCGCAGAGCTTCGACGCCGTGGGGAGCACGTCGGAAGTGGTGCTGAACTCGTCG
ACGTCGAAGCATAGGGAGATTCACCTGGGCATCACGGTCAAGTCGGGAGACGGCAAGTACAAGATGACGCGGGTC
GTGACGCTGGCGCCGCGCTTCGTGCTGGTCAACAAGCTGGGCGAGGAGGTTCTGGTGCGAGAGTCGGGCTCGTCG
AACCACATGACCATCAGATCCGGAGTTCTGCATCCGCTGCATTTCATGCAGAAGTCGGCGGTCAAGCAGCTGTGC
CTGCGCTTCCCGGGCGTCGACAACCACTGGACGTCGCCCTTCAACATCGCCGATCTCGGGACTACGCACGTCAAG
ATGGCCAGGGCCGGACAGCGGCAGCGGCTGGTGCGGGTCGAGATACTCACGGAGGAGTCGACCATCTTCTTGCAC
ATGAGCGTCGAGGGAAAGCACTGGCCCTTTTCCATGCGTAACGAGAGCGACACCGAGTTCTCCTTTTACCAGGCC
AACCCCAACGTCGACGAGGACGACGACGAGGACCGAAGCGGGTGGAAGCCGGTGCGGTACCGGCTGCCGCCTCGG
AGCGTGATGCCGTACGCCTGGGACTTTCCGGCTGCCAAGTTCCGCGAGGTGGTGATTTCTACATGCGGCAAGGAG
CGTCACGTCAAGCTGGCCGAGATGGGCAATCAGATCCCGATGAAGTTTGCCGGACCCGGCGGGCAGCAGAAGATC
ATCGACATCAACGTGGCTGCCGACGGGCCGATGCAGACGCTGATCCTCAGCAACTTCCGGGCCAGCAGGAGCATG
TTCAAGCCGGCAGCGGTGTCGAGGACCAACACGGGGCCCGAGGCGTTCGAGGTCAAGGACCAGGGCACCGGGGCC
ACCATGTTGGCGCAGCTCAAGCTGTCGGGCATCGGCGTCTCGCTCATCAACGCGCACCTCAAGGAGCTGGCGTAC
GTGACGCTTCGCGAGGTGCAGCTACGGCTCAGCGACTCGCCGCTGATACAGACCATGTCGCTGGCGGTCAAGTGG
ATTCAGATAGACAACCAGCTCTACGGCGGCATCTTCCCCATCGTGCTATACCCGAGCGTTGTGCCCAAGCGGGCC
AACGAGGTCGAGGCGCACCCGTCGCTGCACGCCATGGTCAGCCGGGTCAAGGACGACTCGTACGGGGTGCTGTAC
ATCAAGTACGCGACGGTGCTGCTGCAGCAGATGACGGTGGACCTGGACGAGGACTTCGTCTTTGCCCTGCTCGAC
TTCTCCAACGTTCCGGGCGCCAGCTGGACGGCGGTCGAAGGGCCCGGGTCCGGCCGGCTCTGCGACGAGGACCTC
GACATCCCCGAGCCGTCGCAGCAGCAGTCCGGGCAGGACATGTACTTTGAGGTGCTCAACATCCAGCCGATGCAG
ATCGACCTGAGCTTCGTGCGGACGGAGCGGGTCAACGCCGAGGATAAGACGTCGACGCGGAACCCAATCATGTTC
TTCCTCAACGTCATGACCATGGCCATTGGCAACGTCAACGACGCGCCCGTCCGCTTCAACGCCCTGATGCTGGAC
AATGTGAGGGTGTCGCGGGCGGTGCTGGTGCAGAACGTGTCGAGCCACTACAGCCAAGAGGTCATGTATCAGATC
CACAAGATACTGGGCTCGGCCGACTTCCTGGGTAACCCTGTCGGGCTGTTCAACAACATCTCGTCGGGCGTGACG
GACATCTTCTACGAGCCGTACCAGGGGCTCATCCTTTCGGACCGGCCCGAGGAGTTTGGCATCGGCATCGCGCGC
GGAGCCGTCTCGTTCGCCAAGAAGACGGTATACGGCTTCAGCGACAGCTTCTCCAAGTTTACGGGCAGCCTGGGC
AAGGGCCTGGCGGCGGCATCGCTGGACAAGCAGTTCCAGGACCGGCGGCGGATCACGAGGGCTCGCAACCGGCCC
AAGCACGCGCTGTACGGGGTGGCGGCCGGTGCCAACTCGCTGCTGACGAGCGTGGCGTCGGGGGTCGGGGGTTTG
GCGCGCAAGCCGCTCGAGGGCGCCGAGCAAGAGGGCGCCCTGGGCTTCTTCAAGGGCGTGGGCAAGGGCGTGCTC
GGGCTGGCGACGAAGCCGGCGGTAGGGGTGCTGGACATGGCCAGCAACGTCAGCGAGGGCATCCGCAACACGACG
ACGGTCTTTGACGGATCGGAGCTGGAGAGAACGCGGCTTCCGCGCTTCATGGCCAACGACGGCATCGTGCGGCCG
TACGGGGCGCGAGAGGCGCTGGGTCAGTTCTGGCTGAAGCAGGTCGACAACGGCAAGTACTTTGACGAGCAGTAC
GTCGGCCACCTGGAGCTGCCTCGCGAGGACATGGTGGTCATGGTGACGTACGCGCGCATCCTGCTGATCCGGTCT
CGGCGCCTGACGAGCGAGTGGGACGTCAAGCTCAAAGACGTGCAGACGGTGGCCAAGGAGAGGACGGGCGTGAGC
CTGACGCTGCGGGGGGGCACCAACGGGCCGTTCATCCCGGTGGGCGGCGGCAGCGAGCGGGGATATCTGTACCGG
ATGATTGGCGTGGCGGCCGAGGAATTCAATCGGCGTTTCCGGGGCGCCGAGTGA
Transcript >Ophcf2|00644
ATGCTCGAGGGGCTCGCGGCCGGCCTGCTCAACCGCTTCTTGGGCATGTACGTCCAAAACTTCGATCCCACCCAG
CTCAAGGTCGGCATCTGGTCCGGTGACGTCAAGCTCCGCAACCTCGAGCTCCGGCGTGAGGCCCTCGATCAGCTC
AAGCTGCCCATCAACGTCGTCGAGGGCCATCTCGGCCAGCTGACGCTCATCATCCCGTGGTCCAACCTGCGAGGC
GCCCCGGTCAAGGTCTTCGTCGAAGACGTCTTCTTACTCGCTAGCCCAAAGGAAGAGGCCGAATATGATCAGAAG
GAGGAGGAGCAACGAAGCCAGCGGCTCAAGATGGAGAAGCTTGACAGCGCCGAGCTGCTCAAGGAGAAGAATCGA
GAGGGCATGAGTCCCGAAGAGCAGCAAAAGAATCAGAGCTTCACGCAGAGTCTCGTCACCAAGATCGTCGACAAC
CTGCAAATCACCGTCAAGAAGATCCACATCCGATATGAAGATTCCATTTCCGCCCCCGGCCATCCCTTCGCCCTC
GGCCTCACGCTCGAAGAGTTCTCGGCGGTCAGCACCGACGGCGACTGGAAGCCGACTTTTATACAAAACTCGACC
GTCATCACCAACAAGCTGGCCACGCTCGGAGCCTTGGCCGTGTACTGGAACACAGACACTCATCTCATGGGCAGT
GGGCGCGAAGCTGCGCTGCCGCCTGACGAGGCCATGTCCCACGAAGACATGGTGACCAAGTTTCGCTCCCTCATC
GATACGACCGCCTCATCGGACCATCAGTTCATTCTAAAACCCGTCAGCGGCCAGGCCAAGATCGAGCTCAACAAG
TCGGGCGATGTTGTGGCTCCTAAGTTCAAGGTTAACCTGTTGTTCGAGGAGATCGGTCTCGTGCTCGACGACCAC
CAATACCGCGATGCCCTGATGATGGCCGATCTGTTCCATTACTTCATCCGCCACCAGGAGTACAGAGCGCTGAAG
CCCAAGGGCGTTCGACCGAGCCAGGACCCCCGAGCTTGGTTTCGATTCGCAGGCAAGGCCGTGCTCGGCAACATC
CACGAGCGGAACCGCAAGTGGTCCTGGGACTATTTTAGGGAGCGGCGCGACGATCGCATCCGCTACATAGAACTC
TTCAAGAAGAAGAAGGAGCAGCAGCAGCTGTCGCCGGACGAAGAAGAGGATATCGTGACTCTCGAGTGGAAGCTG
GGATACGAAGACTTGCGCTTCTGGCGTTCCCTGGCCCGCAACCAGCTTAAAAAAGAAAACGCGGAGGCTTTGAAA
AGACGAGCCCAGCAGCCTGAGCAGCAGGGCTGGATGTCATGGATCTGGGGCTCGAAGCCGCAAGGAAAGATTGAG
AAGAACGAGGAAAACACTCAGATGACCGAGGAGCAGCGCAAGGAGCTGTACGACATGATTGACTGGGACGAGAAG
ACGGCACTGGCGGAGGCCATCGACGTCCCGCGCGAGGCCGTCAAGCTCTGCATCGAGGCCTGTCTCGGCACCGGG
AGCTTCACCCTCAGACAGGGCAGTCACGGAAAGGCTCCGAGAGACCTGCTCGGGTTATACTTTGACGTCTTCAAA
GCAAAGGCCCTGCAGCGCAAGGACTCGATGCTCGCCAACGTCAGTCTCGGGGGTTTAAGGGTCGAGGACGGCACG
ACACCAGACAGCCTTTACCCCGAGATTGTACGGGTCAAAGACGCTCCCGGGACGAAGCAGCGCAAGAGACTGTCC
CTAGCGGAGCTAGAGAAGAGCAGCGATGAGCCGTTCTTCCAGTTCGAGGTGGAGCAGAACCCGATCGAGCGCGAG
GGCGACATCGCCGTCATGGGCAGTCTGAAGCCCCTCGAGGTCGTGTGGAATCCCAACTTCGTCGTTGGAATCGTT
GACTTCTTCAGACCGCCCGAGAGGCACATGGAGTCCATCACGGCCCTCATGGAAACGGCCGGCGCCACCGTCGAG
GGCATCAGGGAGCAGACACGCGCCGGCCTCGAGTTCGCCCTCGAGGAGCACAAGACCATCAACGCCGAGCTGAGC
CTGCAGGCGCCGCTCATCATCGTACCAGTCAGCATCACGGCCGGGGAGTCTACGTGCGTCATCGTCGACGCTGGC
CACATCCACGTCAACAGCCAGCTGGTAGACCAGGAGACCATGAAGGAGATCCAGGCCAAGCAGCGGCAGACTTAC
AGCGAGGAGGACTTTAAGAGGCTCGAGTCGGTCATGTACGACAAATTCATCGTCAAGCTCACCTCTACCCAGGTC
CTCATCGGGCCTTCGATCGAGAAGACCAAGGCGCAGCTCACGAGGAGGAGCGAAGGCTCCCAGCTGCACGTCGTC
GAGAAGATCAACGTCGACTTTGTCGTGGAGACGTCGATCCTGCCCAAGGCCCCTAACCTGACCAAGTTCAGGGTG
TCCGGCCACATGCCAATGCTCCACGCCTCGGTTTCGGACTCCAAGTACAAGAACCTGATGAAGATCATCGATGTG
GCCATTCCCAAGCTCGGAGGTGAGAGTCGGCAGGACGAAGTGCCGGCGCTCAAGGCCGACGAGGGCGGGCATCCC
CGAGTTGCCCCGCCGCAAGAGCAGACTCGACAGCCTTCGCGACCCCGGCTCGCTAGCAGCGGCTCGAATAGGTCT
CCTGGGCGGAGGTCGCAGCGGGAGAATAGGCAGTCGGCCGGGTTTCCCTTTCTGCAGCCGCCCAGCGCCGTCGTG
CTCGACGACATGGATGATGATCAGGACGACTTCGAGGACGCCTCAGACGGTGCAGACGGGGAACAGCTCAAGATT
CAGCAGCGGAGCTTCGAGTTCAACTTCAAGGTCGATACTCTCAAAGGCTCGCTCTACCGTAGCGATCCGGACCGC
ACCAAGCCCGACGCTCTGTTGGTCGAGCTCGTGGCCGAGCGCTTCGACCTTGCCTTTTACACGAGGCTGTACGAC
ATGTCTGCCGAGGTGTCTCTCGGGGCTGTATCTGTGGACGACTTCGTCGACAATCCCCCTGCAGAGTTCAAGTCC
ATCGTCTCGTCCGGTGACAGTGATGACCTCCAGGAAGGCCGGAGTCTGGTCCACGTCAAGTACATGGATGTCAAG
CCACAGTCGCCCGAGTTTATGCCCGTTTACGAGGGAGTCAAGACGAACATCAGTGCCTCGGTGTTAACCATCAAC
CTCGTCGTGACGAGGAAGACGCTACTGACGCTCCTCGACTTCATTCTCGTCACCTTTGCCGGAGGCAACAACGAC
CAGGAACAAAGCCGAACGGCCGTCACCGATGGTCAAGGCGCCGGACACGAAGAGACGGCTACGGAGCCGGCCAAG
CAAAACGCCGACTCGGGTTCCATCAGAGTCAAGGTGGATCTGAAGGGCATCAGGCTCATCCTCAACAACGACGGC
ATAAGGTTGGCGACGCTGTCGCTCACGGAGGCCGACGCCGGCATATTCCTGCGCGGAAACACGATGCGAATATTT
GCAAAGCTCGGAGATTTGTCTCTCGTCGACGACGTCAACCTGGGCGTCTCCAGGGACTCCAACCTGCGGAGACTC
GTCACCATTCAAGGCGACGAACTCGCCGATTTCCGCTACGAGACGTTTGACGCCGACAACAAGCAGGCGTATCCG
GGCCATGACAGCGCCATCTTCCTGCGGGCCGGTTCGGTCAAGGTAAACTTCGTCGAGGAGCCGTTCCGCAAGATC
ATCGACTTCCTCGTCAAGTTCGGCAGGATGCAAGCCCTTTACAACGCTGCACGACAGGCCGCCGTGACACGGGCC
AACCAGATGCAGCAGAGTCCCAGCAGGTTCAAGTTTGACGTCGTCATCAAGACGCCCATCGTCGTCTTCCCGCGC
TTGATGGTCTCGGAGTCTCCTGAACGCGACGTCGTGACGGCATACCTGGGCGAGATCTATGCGCAGAACGAGTTT
GCGCCTCTCGATGATGGCGAGGCTTCTCGGATCGCCATGAAGATATCCACGGGCATCAGGAAGATCCGGCTTACG
TCCGACTTCAACTACGACAACGACAGATCGGAAGAGCTAGAGATGATAGATCAGGTTGACCTTGGGCTGAGCATC
ACCTATGCCGAGCACAAGCATGGCGTCATGCGCCCAGACACGGAGATCGAGGCGTCCATGTCGGACATCAAGCTC
AGGCTCACGCAGCATCAGCTCAAGTTCCTGCTGGAGATCTCCAAAGCAGTTCCTGCTGCCTTTGCTGGCGACGGC
AGCACCGGCGACGAGGACGCGGCTCAGCTCGTCGACGAGGAGACGCTGCGGCGCGCCAGAACGGCGTCGGCAGAC
CATGGTATCGGCCCTGACCAGCACGCCGTCGACCTCGGGCCCGAGTTGAAGTCGCCTACGGATACGTGGACCCAG
CTCGACTTGGTGTTCCGAGTCGACACCATCGGTCTCGAACTCATCATGGCACCGCTGGACGAGCCCGTGGGCGAC
TTGGCCGCGTCCAGCCTGTCTCGCTTCTCGCTCGACGAAACCAAGGTGAAGACGCGGATGATGTCGGATGGCTCG
CTGGAAGCCGAGTTGCTCATTCGCTCCTTGACCATCTACGACAGCCGTCCGAAAGGAGTCAACAAGTTCCGTCGC
ATCATGAGCTCTTCAAACAAAGAGTCCCAGCAACTCATGGCGAGCGTCACCATGTCGGGCGGCAAGGAGAGCAGC
ATGATCGCCATGGCGACCATCGACAGCCCTCGCGTCATCTTCGCGCTCGACTACCTCTTCGCTCTCCAGGCGTTT
GCCACCGAAGGCCTCAAGGTGGAAGATTCCAGCCCGCTGGACGATGTCAGCACCGACGAGTCACCAGAAGGCTCG
GAAGATGCCGACTCGTTGCGAGTGTCGTCCACTAAGCCTGGTCCGTCTCAGGCGACGTCTCCGCGACGCAGCGAA
TCCAGCTCCGGCGAGCCGCAGAAGCGTCAAGGCGAGGCTTCGATGAGCTTGGCCTTGCGAGTCAACCTCGTCGAC
GCGCAGGTCATACTCATCGCCAACCCGCTGAGGTCCAATTCCGAAGCCATCGTCCTGGGCATCCGACAGGTGCTT
CTATCGCAACAGAACGCACTCACGTTCCAGGTCTCCGAGATGGGCATGTTTCTATGCGTCATGGACAGGTTCGAG
ACGTCGCGCCTCAGAATCATCGACGACTTTTCGATACAGTTGAACATGGACAACTCGCAGCCATTCACGGCCAGC
TATCACGTCGATGTCGAGCCTCTCATCGTTCGACTCTCCCTGAGAGATATTCTCCTCGTGCTCCAGATCGTCGCC
AAAGCCAGCGAGCTCTCGGAAAGCGGGAAAGAGCCGGTCAAAGAGACGCCGGCGGAGCAAAAGGCGAAGCAGCTC
AGAGGCGCCAGCTGCAAGTCAAAGGCCCCCAGCGGCCGCGCCCTGTCGACGGCGGCTCAGACCAAGGCCAACCAG
GCCGTTGTCACCAAAGGAGCCGCGGCGACAAAGCCACGCGGCAGAAGCACGCATGAGGAGCTCTCTGCGACGCTT
CAGGGCATGCGGATCGTGCTGATCGGAGACCTGCACGAGCTGCCCATCGTCGACGTCGGAGTCAAGGAGTTTACG
GCCACGGCAGAGAACTGGTCGTCGAATCTGAAAGCCGAGGCGGCCATACACACGTACACGAACGTCTACAACTTT
TCGAAATCCAGCTGGGAGCCCCTGATCGAACCATGGCAGGTCGGCCTGGGCGTGGCCAGAGACTCGACCACGGGC
GTACTGTCGGTCGACGTGGCCTCGGCCAAGACGCTGGATATCACGATCACGACGGCGACCATCGCAGTGGCTTCC
AAGTCGCTCGACTTTCTCACGACGCAGGAAGACGTCTTGGACAAACCAAGGTGGAGCGACGCGCCTTACCGCATC
AGAAACCACACTGGATTCGTCATCACGATGCACTCGCGAAGCCCAAGCAGCGAAGAGTCCATCGACCTGCGGCTC
GACGACGGAGAGGAGGCACCGTGGACCTTTGAAGAATGGGAGAAGATGCGCGAGAACATCCTGACCAAAGGCGCC
GCCCAGAATGACGTGGGCATCAAGTTGGAGGGCAGCGGCTTCGACACCGTGAAGAACGTGCGGGTGAACCGAGAG
GGCGAGTATCTCTACAGCCTGCGGCCCAAGACGGACAACGTGACGCATCGGCTGTGCGTCGACGTACGTCTCGGG
TCTGACAATGTCAAGGACGTGACGCTACGATCTCCGCTGCTCGTCGAGAACGCGACGGAGATCCCGGTCGAGCTC
GGCATCTACGACGCTTCAGAGGGTCACCTTCTCAAGATCGAGAAGATCGCTCCCGGGGACTCGCGTCCGGCCCCG
GTCGGCGCCGCGTACGAAAAGAAGATGATTGTGCGTCCGGACAGCGGCTTCGGCTATCAGTGGAGCAGAGACCAG
CTCTGGTGGAGGGATCTGCTCAAGCGACCGACCAAGCAGCTCGTCTGCACGGGGGATACCGGCGATTCGTTCTAC
TTTCAGGTCCACGCGGACTTTGACAAGACCAACCCATTGACCAAGGCATATCCGTCGATGAAGATCAAGCTCTCG
GCTCCGGTGACGCTGGAAAACCTGTTGCCGTACGACTTCAAGTACAGGATCTACGACAGGAACACCAAGAAGGAC
TGGTCCAACTTTCTGAGAAAGGGCGGCGTGAGCCCCGTCCACATGGTGGAGCTCTCTCATCTCCTACTCCTGAGC
GTCGATATGCAGGACACCATCTTCAAGCCGAGCGACTTCTCCATCATCAACTCCGGAAGCAACGACGACTTCCGC
AAGGAGAAGCGGCTCCTGGTCAGGGACGAGCAAGGCCTGACGCTGCACCTCAGCCTCCACTACTTCAAAGTGCCC
AAGAGCGGCGGCGCGTTCAAGATCAGCGTGTACAGCCCCTACGTCGTGTTGAACAAGACGGGTCTCGACATGGGG
ATCCGCGCCAAGAGCTTCCTACAGCAGGCCAAGGCGGCGGCCGGTCAGTTCCCCGTGGCGCAGACGGGAAGCCAA
GATAGGCCGAAGGCGCTGCCGTTCATGTTCTCGTTCGGAAACGACGAGCATCAGAACCGGGCGCTGCTCAAGGTG
GACGAGTCGGAGTGGAGCAAGCCGCAGAGCTTCGACGCCGTGGGGAGCACGTCGGAAGTGGTGCTGAACTCGTCG
ACGTCGAAGCATAGGGAGATTCACCTGGGCATCACGGTCAAGTCGGGAGACGGCAAGTACAAGATGACGCGGGTC
GTGACGCTGGCGCCGCGCTTCGTGCTGGTCAACAAGCTGGGCGAGGAGGTTCTGGTGCGAGAGTCGGGCTCGTCG
AACCACATGACCATCAGATCCGGAGTTCTGCATCCGCTGCATTTCATGCAGAAGTCGGCGGTCAAGCAGCTGTGC
CTGCGCTTCCCGGGCGTCGACAACCACTGGACGTCGCCCTTCAACATCGCCGATCTCGGGACTACGCACGTCAAG
ATGGCCAGGGCCGGACAGCGGCAGCGGCTGGTGCGGGTCGAGATACTCACGGAGGAGTCGACCATCTTCTTGCAC
ATGAGCGTCGAGGGAAAGCACTGGCCCTTTTCCATGCGTAACGAGAGCGACACCGAGTTCTCCTTTTACCAGGCC
AACCCCAACGTCGACGAGGACGACGACGAGGACCGAAGCGGGTGGAAGCCGGTGCGGTACCGGCTGCCGCCTCGG
AGCGTGATGCCGTACGCCTGGGACTTTCCGGCTGCCAAGTTCCGCGAGGTGGTGATTTCTACATGCGGCAAGGAG
CGTCACGTCAAGCTGGCCGAGATGGGCAATCAGATCCCGATGAAGTTTGCCGGACCCGGCGGGCAGCAGAAGATC
ATCGACATCAACGTGGCTGCCGACGGGCCGATGCAGACGCTGATCCTCAGCAACTTCCGGGCCAGCAGGAGCATG
TTCAAGCCGGCAGCGGTGTCGAGGACCAACACGGGGCCCGAGGCGTTCGAGGTCAAGGACCAGGGCACCGGGGCC
ACCATGTTGGCGCAGCTCAAGCTGTCGGGCATCGGCGTCTCGCTCATCAACGCGCACCTCAAGGAGCTGGCGTAC
GTGACGCTTCGCGAGGTGCAGCTACGGCTCAGCGACTCGCCGCTGATACAGACCATGTCGCTGGCGGTCAAGTGG
ATTCAGATAGACAACCAGCTCTACGGCGGCATCTTCCCCATCGTGCTATACCCGAGCGTTGTGCCCAAGCGGGCC
AACGAGGTCGAGGCGCACCCGTCGCTGCACGCCATGGTCAGCCGGGTCAAGGACGACTCGTACGGGGTGCTGTAC
ATCAAGTACGCGACGGTGCTGCTGCAGCAGATGACGGTGGACCTGGACGAGGACTTCGTCTTTGCCCTGCTCGAC
TTCTCCAACGTTCCGGGCGCCAGCTGGACGGCGGTCGAAGGGCCCGGGTCCGGCCGGCTCTGCGACGAGGACCTC
GACATCCCCGAGCCGTCGCAGCAGCAGTCCGGGCAGGACATGTACTTTGAGGTGCTCAACATCCAGCCGATGCAG
ATCGACCTGAGCTTCGTGCGGACGGAGCGGGTCAACGCCGAGGATAAGACGTCGACGCGGAACCCAATCATGTTC
TTCCTCAACGTCATGACCATGGCCATTGGCAACGTCAACGACGCGCCCGTCCGCTTCAACGCCCTGATGCTGGAC
AATGTGAGGGTGTCGCGGGCGGTGCTGGTGCAGAACGTGTCGAGCCACTACAGCCAAGAGGTCATGTATCAGATC
CACAAGATACTGGGCTCGGCCGACTTCCTGGGTAACCCTGTCGGGCTGTTCAACAACATCTCGTCGGGCGTGACG
GACATCTTCTACGAGCCGTACCAGGGGCTCATCCTTTCGGACCGGCCCGAGGAGTTTGGCATCGGCATCGCGCGC
GGAGCCGTCTCGTTCGCCAAGAAGACGGTATACGGCTTCAGCGACAGCTTCTCCAAGTTTACGGGCAGCCTGGGC
AAGGGCCTGGCGGCGGCATCGCTGGACAAGCAGTTCCAGGACCGGCGGCGGATCACGAGGGCTCGCAACCGGCCC
AAGCACGCGCTGTACGGGGTGGCGGCCGGTGCCAACTCGCTGCTGACGAGCGTGGCGTCGGGGGTCGGGGGTTTG
GCGCGCAAGCCGCTCGAGGGCGCCGAGCAAGAGGGCGCCCTGGGCTTCTTCAAGGGCGTGGGCAAGGGCGTGCTC
GGGCTGGCGACGAAGCCGGCGGTAGGGGTGCTGGACATGGCCAGCAACGTCAGCGAGGGCATCCGCAACACGACG
ACGGTCTTTGACGGATCGGAGCTGGAGAGAACGCGGCTTCCGCGCTTCATGGCCAACGACGGCATCGTGCGGCCG
TACGGGGCGCGAGAGGCGCTGGGTCAGTTCTGGCTGAAGCAGGTCGACAACGGCAAGTACTTTGACGAGCAGTAC
GTCGGCCACCTGGAGCTGCCTCGCGAGGACATGGTGGTCATGGTGACGTACGCGCGCATCCTGCTGATCCGGTCT
CGGCGCCTGACGAGCGAGTGGGACGTCAAGCTCAAAGACGTGCAGACGGTGGCCAAGGAGAGGACGGGCGTGAGC
CTGACGCTGCGGGGGGGCACCAACGGGCCGTTCATCCCGGTGGGCGGCGGCAGCGAGCGGGGATATCTGTACCGG
ATGATTGGCGTGGCGGCCGAGGAATTCAATCGGCGTTTCCGGGGCGCCGAGTGA
Gene >Ophcf2|00644
ATGCTCGAGGGGCTCGCGGCCGGCCTGCTCAACCGCTTCTTGGGCATGTACGTCCAAAACTTCGATCCCACCCAG
CTCAAGGTCGGCATCTGGTCCGGTGACGTCAAGCTCCGCAACCTCGAGCTCCGGCGTGAGGCCCTCGATCAGCTC
AAGCTGCCCATCAACGTCGTCGAGGGCCATCTCGGCCAGCTGACGCTCATCATCCCGTGGTCCAACCTGCGAGGC
GCCCCGGTCAAGGTCTTCGTCGAAGACGTCTTCTTACTCGCTAGCCCAAAGGAAGAGGCCGAATATGATCAGAAG
GAGGAGGAGCAACGAAGCCAGCGGCTCAAGATGGAGAAGCTTGACAGCGCCGAGCTGCTCAAGGAGAAGAATCGA
GAGGGCATGAGTCCCGAAGAGCAGCAAAAGAATCAGAGCTTCACGCAGAGTCTCGTCACCAAGATCGTCGACAAC
CTGCAAATCACCGTCAAGAAGATCCACATCCGATATGAAGATTCCATTTCCGCCCCCGGCCATCCCTTCGCCCTC
GGCCTCACGCTCGAAGAGTTCTCGGCGGTCAGCACCGACGGCGACTGGAAGCCGACTTTTATACAAAACTCGACC
GTCATCACCAACAAGCTGGCCACGCTCGGAGCCTTGGCCGTGTACTGGAACACAGACACTCATCTCATGGGCAGT
GGGCGCGAAGCTGCGCTGCCGCCTGACGAGGCCATGTCCCACGAAGACATGGTGACCAAGTTTCGCTCCCTCATC
GATACGACCGCCTCATCGGACCATCAGTTCATTCTAAAACCCGTCAGCGGCCAGGCCAAGATCGAGCTCAACAAG
TCGGGCGATGTTGTGGCTCCTAAGTTCAAGGTTAACCTGTTGTTCGAGGAGATCGGTCTCGTGCTCGACGACCAC
CAATACCGCGATGCCCTGATGATGGCCGATCTGTTCCATTACTTCATCCGCCACCAGGAGTACAGAGCGCTGAAG
CCCAAGGGCGTTCGACCGAGCCAGGACCCCCGAGCTTGGTTTCGATTCGCAGGCAAGGCCGTGCTCGGCAACATC
CACGAGCGGAACCGCAAGTGGTCCTGGGACTATTTTAGGGAGCGGCGCGACGATCGCATCCGCTACATAGAACTC
TTCAAGAAGAAGAAGGAGCAGCAGCAGCTGTCGCCGGACGAAGAAGAGGATATCGTGACTCTCGAGTGGAAGCTG
GGATACGAAGACTTGCGCTTCTGGCGTTCCCTGGCCCGCAACCAGCTTAAAAAAGAAAACGCGGAGGCTTTGAAA
AGACGAGCCCAGCAGCCTGAGCAGCAGGGCTGGATGTCATGGATCTGGGGCTCGAAGCCGCAAGGAAAGATTGAG
AAGAACGAGGAAAACACTCAGATGACCGAGGAGCAGCGCAAGGAGCTGTACGACATGATTGACTGGGACGAGAAG
ACGGCACTGGCGGAGGCCATCGACGTCCCGCGCGAGGCCGTCAAGCTCTGCATCGAGGCCTGTCTCGGCACCGGG
AGCTTCACCCTCAGACAGGGCAGTCACGGAAAGGCTCCGAGAGACCTGCTCGGGTTATACTTTGACGTCTTCAAA
GCAAAGGCCCTGCAGCGCAAGGACTCGATGCTCGCCAACGTCAGTCTCGGGGGTTTAAGGGTCGAGGACGGCACG
ACACCAGACAGCCTTTACCCCGAGATTGTACGGGTCAAAGACGCTCCCGGGACGAAGCAGCGCAAGAGACTGTCC
CTAGCGGAGCTAGAGAAGAGCAGCGATGAGCCGTTCTTCCAGTTCGAGGTGGAGCAGAACCCGATCGAGCGCGAG
GGCGACATCGCCGTCATGGGCAGTCTGAAGCCCCTCGAGGTCGTGTGGAATCCCAACTTCGTCGTTGGAATCGTT
GACTTCTTCAGACCGCCCGAGAGGCACATGGAGTCCATCACGGCCCTCATGGAAACGGCCGGCGCCACCGTCGAG
GGCATCAGGGAGCAGACACGCGCCGGCCTCGAGTTCGCCCTCGAGGAGCACAAGACCATCAACGCCGAGCTGAGC
CTGCAGGCGCCGCTCATCATCGTACCAGTCAGCATCACGGCCGGGGAGTCTACGTGCGTCATCGTCGACGCTGGC
CACATCCACGTCAACAGCCAGCTGGTAGACCAGGAGACCATGAAGGAGATCCAGGCCAAGCAGCGGCAGACTTAC
AGCGAGGAGGACTTTAAGAGGCTCGAGTCGGTCATGTACGACAAATTCATCGTCAAGCTCACCTCTACCCAGGTC
CTCATCGGGCCTTCGATCGAGAAGACCAAGGCGCAGCTCACGAGGAGGAGCGAAGGCTCCCAGCTGCACGTCGTC
GAGAAGATCAACGTCGACTTTGTCGTGGAGACGTCGATCCTGCCCAAGGCCCCTAACCTGACCAAGTTCAGGGTG
TCCGGCCACATGCCAATGCTCCACGCCTCGGTTTCGGACTCCAAGTACAAGAACCTGATGAAGATCATCGATGTG
GCCATTCCCAAGCTCGGAGGTGAGAGTCGGCAGGACGAAGTGCCGGCGCTCAAGGCCGACGAGGGCGGGCATCCC
CGAGTTGCCCCGCCGCAAGAGCAGACTCGACAGCCTTCGCGACCCCGGCTCGCTAGCAGCGGCTCGAATAGGTCT
CCTGGGCGGAGGTCGCAGCGGGAGAATAGGCAGTCGGCCGGGTTTCCCTTTCTGCAGCCGCCCAGCGCCGTCGTG
CTCGACGACATGGATGATGATCAGGACGACTTCGAGGACGCCTCAGACGGTGCAGACGGGGAACAGCTCAAGATT
CAGCAGCGGAGCTTCGAGTTCAACTTCAAGGTCGATACTCTCAAAGGCTCGCTCTACCGTAGCGATCCGGACCGC
ACCAAGCCCGACGCTCTGTTGGTCGAGCTCGTGGCCGAGCGCTTCGACCTTGCCTTTTACACGAGGCTGTACGAC
ATGTCTGCCGAGGTGTCTCTCGGGGCTGTATCTGTGGACGACTTCGTCGACAATCCCCCTGCAGAGTTCAAGTCC
ATCGTCTCGTCCGGTGACAGTGATGACCTCCAGGAAGGCCGGAGTCTGGTCCACGTCAAGTACATGGATGTCAAG
CCACAGTCGCCCGAGTTTATGCCCGTTTACGAGGGAGTCAAGACGAACATCAGTGCCTCGGTGTTAACCATCAAC
CTCGTCGTGACGAGGAAGACGCTACTGACGCTCCTCGACTTCATTCTCGTCACCTTTGCCGGAGGCAACAACGAC
CAGGAACAAAGCCGAACGGCCGTCACCGATGGTCAAGGCGCCGGACACGAAGAGACGGCTACGGAGCCGGCCAAG
CAAAACGCCGACTCGGGTTCCATCAGAGTCAAGGTGGATCTGAAGGGCATCAGGCTCATCCTCAACAACGACGGC
ATAAGGTTGGCGACGCTGTCGCTCACGGAGGCCGACGCCGGCATATTCCTGCGCGGAAACACGATGCGAATATTT
GCAAAGCTCGGAGATTTGTCTCTCGTCGACGACGTCAACCTGGGCGTCTCCAGGGACTCCAACCTGCGGAGACTC
GTCACCATTCAAGGCGACGAACTCGCCGATTTCCGCTACGAGACGTTTGACGCCGACAACAAGCAGGCGTATCCG
GGCCATGACAGCGCCATCTTCCTGCGGGCCGGTTCGGTCAAGGTAAACTTCGTCGAGGAGCCGTTCCGCAAGATC
ATCGACTTCCTCGTCAAGTTCGGCAGGATGCAAGCCCTTTACAACGCTGCACGACAGGCCGCCGTGACACGGGCC
AACCAGATGCAGCAGAGTCCCAGCAGGTTCAAGTTTGACGTCGTCATCAAGACGCCCATCGTCGTCTTCCCGCGC
TTGATGGTCTCGGAGTCTCCTGAACGCGACGTCGTGACGGCATACCTGGGCGAGATCTATGCGCAGAACGAGTTT
GCGCCTCTCGATGATGGCGAGGCTTCTCGGATCGCCATGAAGATATCCACGGGCATCAGGAAGATCCGGCTTACG
TCCGACTTCAACTACGACAACGACAGATCGGAAGAGCTAGAGATGATAGATCAGGTTGACCTTGGGCTGAGCATC
ACCTATGCCGAGCACAAGCATGGCGTCATGCGCCCAGACACGGAGATCGAGGCGTCCATGTCGGACATCAAGCTC
AGGCTCACGCAGCATCAGCTCAAGTTCCTGCTGGAGATCTCCAAAGCAGTTCCTGCTGCCTTTGCTGGCGACGGC
AGCACCGGCGACGAGGACGCGGCTCAGCTCGTCGACGAGGAGACGCTGCGGCGCGCCAGAACGGCGTCGGCAGAC
CATGGTATCGGCCCTGACCAGCACGCCGTCGACCTCGGGCCCGAGTTGAAGTCGCCTACGGATACGTGGACCCAG
CTCGACTTGGTGTTCCGAGTCGACACCATCGGTCTCGAACTCATCATGGCACCGCTGGACGAGCCCGTGGGCGAC
TTGGCCGCGTCCAGCCTGTCTCGCTTCTCGCTCGACGAAACCAAGGTGAAGACGCGGATGATGTCGGATGGCTCG
CTGGAAGCCGAGTTGCTCATTCGCTCCTTGACCATCTACGACAGCCGTCCGAAAGGAGTCAACAAGTTCCGTCGC
ATCATGAGCTCTTCAAACAAAGAGTCCCAGCAACTCATGGCGAGCGTCACCATGTCGGGCGGCAAGGAGAGCAGC
ATGATCGCCATGGCGACCATCGACAGCCCTCGCGTCATCTTCGCGCTCGACTACCTCTTCGCTCTCCAGGCGTTT
GCCACCGAAGGCCTCAAGGTGGAAGATTCCAGCCCGCTGGACGATGTCAGCACCGACGAGTCACCAGAAGGCTCG
GAAGATGCCGACTCGTTGCGAGTGTCGTCCACTAAGCCTGGTCCGTCTCAGGCGACGTCTCCGCGACGCAGCGAA
TCCAGCTCCGGCGAGCCGCAGAAGCGTCAAGGCGAGGCTTCGATGAGCTTGGCCTTGCGAGTCAACCTCGTCGAC
GCGCAGGTCATACTCATCGCCAACCCGCTGAGGTCCAATTCCGAAGCCATCGTCCTGGGCATCCGACAGGTGCTT
CTATCGCAACAGAACGCACTCACGTTCCAGGTCTCCGAGATGGGCATGTTTCTATGCGTCATGGACAGGTTCGAG
ACGTCGCGCCTCAGAATCATCGACGACTTTTCGATACAGTTGAACATGGACAACTCGCAGCCATTCACGGCCAGC
TATCACGTCGATGTCGAGCCTCTCATCGTTCGACTCTCCCTGAGAGATATTCTCCTCGTGCTCCAGATCGTCGCC
AAAGCCAGCGAGCTCTCGGAAAGCGGGAAAGAGCCGGTCAAAGAGACGCCGGCGGAGCAAAAGGCGAAGCAGCTC
AGAGGCGCCAGCTGCAAGTCAAAGGCCCCCAGCGGCCGCGCCCTGTCGACGGCGGCTCAGACCAAGGCCAACCAG
GCCGTTGTCACCAAAGGAGCCGCGGCGACAAAGCCACGCGGCAGAAGCACGCATGAGGAGCTCTCTGCGACGCTT
CAGGGCATGCGGATCGTGCTGATCGGAGACCTGCACGAGCTGCCCATCGTCGACGTCGGAGTCAAGGAGTTTACG
GCCACGGCAGAGAACTGGTCGTCGAATCTGAAAGCCGAGGCGGCCATACACACGTACACGAACGTCTACAACTTT
TCGAAATCCAGCTGGGAGCCCCTGATCGAACCATGGCAGGTCGGCCTGGGCGTGGCCAGAGACTCGACCACGGGC
GTACTGTCGGTCGACGTGGCCTCGGCCAAGACGCTGGATATCACGATCACGACGGCGACCATCGCAGTGGCTTCC
AAGTCGCTCGACTTTCTCACGACGCAGGAAGACGTCTTGGACAAACCAAGGTGGAGCGACGCGCCTTACCGCATC
AGAAACCACACTGGATTCGTCATCACGATGCACTCGCGAAGCCCAAGCAGCGAAGAGTCCATCGACCTGCGGCTC
GACGACGGAGAGGAGGCACCGTGGACCTTTGAAGAATGGGAGAAGATGCGCGAGAACATCCTGACCAAAGGCGCC
GCCCAGAATGACGTGGGCATCAAGTTGGAGGGCAGCGGCTTCGACACCGTGAAGAACGTGCGGGTGAACCGAGAG
GGCGAGTATCTCTACAGCCTGCGGCCCAAGACGGACAACGTGACGCATCGGCTGTGCGTCGACGTACGTCTCGGG
TCTGACAATGTCAAGGACGTGACGCTACGATCTCCGCTGCTCGTCGAGAACGCGACGGAGATCCCGGTCGAGCTC
GGCATCTACGACGCTTCAGAGGGTCACCTTCTCAAGATCGAGAAGATCGCTCCCGGGGACTCGCGTCCGGCCCCG
GTCGGCGCCGCGTACGAAAAGAAGATGATTGTGCGTCCGGACAGCGGCTTCGGCTATCAGTGGAGCAGAGACCAG
CTCTGGTGGAGGGATCTGCTCAAGCGACCGACCAAGCAGCTCGTCTGCACGGGGGATACCGGCGATTCGTTCTAC
TTTCAGGTCCACGCGGACTTTGACAAGACCAACCCATTGACCAAGTGAGTATCTTTGTTCTCCCGGCCGGTTCTG
CGTTAATGGAGGAATCAAAAAAGGGCATATCCGTCGATGAAGATCAAGCTCTCGGCTCCGGTGACGCTGGAAAAC
CTGTTGCCGTACGACTTCAAGTACAGGATCTACGACAGGAACACCAAGAAGGACTGGTCCAACTTTCTGAGAAAG
GGCGGCGTGAGCCCCGTCCACATGGTGGAGCTCTCTCATCTCCTACTCCTGAGCGTCGATATGCAGGACACCATC
TTCAAGCCGAGCGACTTCTCCATCATCAACTCCGGAAGCAACGACGACTTCCGCAAGGAGAAGCGGCTCCTGGTC
AGGGACGAGCAAGGCCTGACGCTGCACCTCAGCCTCCACTACTTCAAAGTGCCCAAGAGCGGCGGCGCGTTCAAG
ATCAGCGTGTACAGCCCCTACGTCGTGTTGAACAAGACGGGTCTCGACATGGGGATCCGCGCCAAGAGCTTCCTA
CAGCAGGCCAAGGCGGCGGCCGGTCAGTTCCCCGTGGCGCAGACGGGAAGCCAAGATAGGCCGAAGGCGCTGCCG
TTCATGTTCTCGTTCGGAAACGACGAGCATCAGAACCGGGCGCTGCTCAAGGTGGACGAGTCGGAGTGGAGCAAG
CCGCAGAGCTTCGACGCCGTGGGGAGCACGTCGGAAGTGGTGCTGAACTCGTCGACGTCGAAGCATAGGGAGATT
CACCTGGGCATCACGGTCAAGTCGGGAGACGGCAAGTACAAGATGACGCGGGTCGTGACGCTGGCGCCGCGCTTC
GTGCTGGTCAACAAGCTGGGCGAGGAGGTTCTGGTGCGAGAGTCGGGCTCGTCGAACCACATGACCATCAGATCC
GGAGTTCTGCATCCGCTGCATTTCATGCAGAAGTCGGCGGTCAAGCAGCTGTGCCTGCGCTTCCCGGGCGTCGAC
AACCACTGGACGTCGCCCTTCAACATCGCCGATCTCGGGACTACGCACGTCAAGATGGCCAGGGCCGGACAGCGG
CAGCGGCTGGTGCGGGTCGAGATACTCACGGAGGAGTCGACCATCTTCTTGCACATGAGCGTCGAGGGAAAGCAC
TGGCCCTTTTCCATGCGTAACGAGAGCGACACCGAGTTCTCCTTTTACCAGGCCAACCCCAACGTCGACGAGGAC
GACGACGAGGACCGAAGCGGGTGGAAGCCGGTGCGGTACCGGCTGCCGCCTCGGAGCGTGATGCCGTACGCCTGG
GACTTTCCGGCTGCCAAGTTCCGCGAGGTGGTGATTTCTACATGCGGCAAGGAGCGTCACGTCAAGCTGGCCGAG
ATGGGCAATCAGATCCCGATGAAGTTTGCCGGACCCGGCGGGCAGCAGAAGATCATCGACATCAACGTGGCTGCC
GACGGGCCGATGCAGACGCTGATCCTCAGCAACTTCCGGGCCAGCAGGAGCATGTTCAAGCCGGCAGCGGTGTCG
AGGACCAACACGGGGCCCGAGGCGTTCGAGGTCAAGGACCAGGGCACCGGGGCCACCATGTTGGCGCAGCTCAAG
CTGTCGGGCATCGGCGTCTCGCTCATCAACGCGCACCTCAAGGAGCTGGCGTACGTGACGCTTCGCGAGGTGCAG
CTACGGCTCAGCGACTCGCCGCTGATACAGACCATGTCGCTGGCGGTCAAGTGGATTCAGATAGACAACCAGCTC
TACGGCGGCATCTTCCCCATCGTGCTATACCCGAGCGTTGTGCCCAAGCGGGCCAACGAGGTCGAGGCGCACCCG
TCGCTGCACGCCATGGTCAGCCGGGTCAAGGACGACTCGTACGGGGTGCTGTACATCAAGTACGCGACGGTGCTG
CTGCAGCAGATGACGGTGGACCTGGACGAGGACTTCGTCTTTGCCCTGCTCGACTTCTCCAACGTTCCGGGCGCC
AGCTGGACGGCGGTCGAAGGGCCCGGGTCCGGCCGGCTCTGCGACGAGGACCTCGACATCCCCGAGCCGTCGCAG
CAGCAGTCCGGGCAGGACATGTACTTTGAGGTGCTCAACATCCAGCCGATGCAGATCGACCTGAGCTTCGTGCGG
ACGGAGCGGGTCAACGCCGAGGATAAGACGTCGACGCGGAACCCAATCATGTTCTTCCTCAACGTCATGACCATG
GCCATTGGCAACGTCAACGACGCGCCCGTCCGCTTCAACGCCCTGATGCTGGACAATGTGAGGGTGTCGCGGGCG
GTGCTGGTGCAGAACGTGTCGAGCCACTACAGCCAAGAGGTCATGTATCAGATCCACAAGATACTGGGCTCGGCC
GACTTCCTGGGTAACCCTGTCGGGCTGTTCAACAACATCTCGTCGGGCGTGACGGACATCTTCTACGAGCCGTAC
CAGGGGCTCATCCTTTCGGACCGGCCCGAGGAGTTTGGCATCGGCATCGCGCGCGGAGCCGTCTCGTTCGCCAAG
AAGACGGTATACGGCTTCAGCGACAGCTTCTCCAAGTTTACGGGCAGCCTGGGCAAGGGCCTGGCGGCGGCATCG
CTGGACAAGCAGTTCCAGGACCGGCGGCGGATCACGAGGGCTCGCAACCGGCCCAAGCACGCGCTGTACGGGGTG
GCGGCCGGTGCCAACTCGCTGCTGACGAGCGTGGCGTCGGGGGTCGGGGGTTTGGCGCGCAAGCCGCTCGAGGGC
GCCGAGCAAGAGGGCGCCCTGGGCTTCTTCAAGGGCGTGGGCAAGGGCGTGCTCGGGCTGGCGACGAAGCCGGCG
GTAGGGGTGCTGGACATGGCCAGCAACGTCAGCGAGGGCATCCGCAACACGACGACGGTCTTTGACGGATCGGAG
CTGGAGAGAACGCGGCTTCCGCGCTTCATGGCCAACGACGGCATCGTGCGGCCGTACGGGGCGCGAGAGGCGCTG
GGTCAGTTCTGGCTGAAGCAGGTCGACAACGGCAAGTACTTTGACGAGCAGTACGTCGGCCACCTGGAGCTGCCT
CGCGAGGACATGGTGGTCATGGTGACGTACGCGCGCATCCTGCTGATCCGGTCTCGGCGCCTGACGAGCGAGTGG
GACGTCAAGCTCAAAGACGTGCAGACGGTGGCCAAGGAGAGGACGGGCGTGAGCCTGACGCTGCGGGGGGGCACC
AACGGGCCGTTCATCCCGGTGGGCGGCGGCAGCGAGCGGGGATATCTGTACCGGATGATTGGCGTGGCGGCCGAG
GAATTCAATCGGCGTTTCCGGGGCGCCGAGTGA

© 2023 - Robin Ohm - Utrecht University - The Netherlands

Built with Python Django and Wagtail