Fungal Genomics

at Utrecht University

General Properties

Protein IDOphcf2|00644
Gene name
Locationscaffold_01:2489653..2499361
Strand-
Gene length (bp)9708
Transcript length (bp)9654
Coding sequence length (bp)9654
Protein length (aa) 3218

Overview

Your browser does not support drawing a protein figure.

PFAM Domains

PFAM Domain ID Short name Long name E-value Start End
PF06650 SHR-BD SHR-binding domain of vacuolar-sorting associated protein 13 1.0E-91 2281 2563
PF16910 VPS13_mid_rpt Repeating coiled region of VPS13 4.2E-90 592 828
PF16908 VPS13 Vacuolar sorting-associated protein 13, N-terminal 4.7E-85 139 378
PF16909 VPS13_C Vacuolar-sorting-associated 13 protein C-terminal 4.6E-70 2813 2988
PF12624 Chorein_N N-terminal region of Chorein or VPS13 2.2E-39 2 115

GO

(None)

Deeploc

[Help with interpreting the results of Deeploc 2.0]
Localizations Signals Cytoplasm Nucleus Extracellular Cell membrane Mitochondrion Plastid Endoplasmic reticulum Lysosome vacuole Golgi apparatus Peroxisome
Cytoplasm|Lysosome/Vacuole 0.4966 0.2874 0.0683 0.1615 0.6299 0.0823 0.4066 0.6738 0.4997 0.0124

SignalP

(None)

Transmembrane Domains

(None)

Transcription Factor Class

(None)

CAZymes

(None)

Secondary Metabolism

(None)

Expression data

Analysis 1: Expression analysis during behavioral modification. Published in: Will et al., G3, 2020

Click here for more information

Orthologs

Orthofinder run ID4
Orthogroup2095
Change Orthofinder run
Species Protein ID
Ophiocordyceps australis 1348a (Ghana) OphauG2|3932
Ophiocordyceps australis map64 (Brazil) OphauB2|7982
Ophiocordyceps camponoti-floridani Ophcf2|00644 (this protein)
Ophiocordyceps camponoti-rufipedis Ophun1|2027
Ophiocordyceps kimflemingae Ophio5|4142
Ophiocordyceps subramaniannii Hirsu2|2462

Sequences

Type of sequenceSequence
Locus Download genbank file of locus Download genbank file of locus (reverse complement)
The gene with 5 kb flanks (if sufficient flanking sequence is available). For use in cloning design programs. NOTE: features (genes or exons) that are only partially contained within the sequence are completely excluded.
Protein >Ophcf2|00644
MLEGLAAGLLNRFLGMYVQNFDPTQLKVGIWSGDVKLRNLELRREALDQLKLPINVVEGHLGQLTLIIPWSNLRG
APVKVFVEDVFLLASPKEEAEYDQKEEEQRSQRLKMEKLDSAELLKEKNREGMSPEEQQKNQSFTQSLVTKIVDN
LQITVKKIHIRYEDSISAPGHPFALGLTLEEFSAVSTDGDWKPTFIQNSTVITNKLATLGALAVYWNTDTHLMGS
GREAALPPDEAMSHEDMVTKFRSLIDTTASSDHQFILKPVSGQAKIELNKSGDVVAPKFKVNLLFEEIGLVLDDH
QYRDALMMADLFHYFIRHQEYRALKPKGVRPSQDPRAWFRFAGKAVLGNIHERNRKWSWDYFRERRDDRIRYIEL
FKKKKEQQQLSPDEEEDIVTLEWKLGYEDLRFWRSLARNQLKKENAEALKRRAQQPEQQGWMSWIWGSKPQGKIE
KNEENTQMTEEQRKELYDMIDWDEKTALAEAIDVPREAVKLCIEACLGTGSFTLRQGSHGKAPRDLLGLYFDVFK
AKALQRKDSMLANVSLGGLRVEDGTTPDSLYPEIVRVKDAPGTKQRKRLSLAELEKSSDEPFFQFEVEQNPIERE
GDIAVMGSLKPLEVVWNPNFVVGIVDFFRPPERHMESITALMETAGATVEGIREQTRAGLEFALEEHKTINAELS
LQAPLIIVPVSITAGESTCVIVDAGHIHVNSQLVDQETMKEIQAKQRQTYSEEDFKRLESVMYDKFIVKLTSTQV
LIGPSIEKTKAQLTRRSEGSQLHVVEKINVDFVVETSILPKAPNLTKFRVSGHMPMLHASVSDSKYKNLMKIIDV
AIPKLGGESRQDEVPALKADEGGHPRVAPPQEQTRQPSRPRLASSGSNRSPGRRSQRENRQSAGFPFLQPPSAVV
LDDMDDDQDDFEDASDGADGEQLKIQQRSFEFNFKVDTLKGSLYRSDPDRTKPDALLVELVAERFDLAFYTRLYD
MSAEVSLGAVSVDDFVDNPPAEFKSIVSSGDSDDLQEGRSLVHVKYMDVKPQSPEFMPVYEGVKTNISASVLTIN
LVVTRKTLLTLLDFILVTFAGGNNDQEQSRTAVTDGQGAGHEETATEPAKQNADSGSIRVKVDLKGIRLILNNDG
IRLATLSLTEADAGIFLRGNTMRIFAKLGDLSLVDDVNLGVSRDSNLRRLVTIQGDELADFRYETFDADNKQAYP
GHDSAIFLRAGSVKVNFVEEPFRKIIDFLVKFGRMQALYNAARQAAVTRANQMQQSPSRFKFDVVIKTPIVVFPR
LMVSESPERDVVTAYLGEIYAQNEFAPLDDGEASRIAMKISTGIRKIRLTSDFNYDNDRSEELEMIDQVDLGLSI
TYAEHKHGVMRPDTEIEASMSDIKLRLTQHQLKFLLEISKAVPAAFAGDGSTGDEDAAQLVDEETLRRARTASAD
HGIGPDQHAVDLGPELKSPTDTWTQLDLVFRVDTIGLELIMAPLDEPVGDLAASSLSRFSLDETKVKTRMMSDGS
LEAELLIRSLTIYDSRPKGVNKFRRIMSSSNKESQQLMASVTMSGGKESSMIAMATIDSPRVIFALDYLFALQAF
ATEGLKVEDSSPLDDVSTDESPEGSEDADSLRVSSTKPGPSQATSPRRSESSSGEPQKRQGEASMSLALRVNLVD
AQVILIANPLRSNSEAIVLGIRQVLLSQQNALTFQVSEMGMFLCVMDRFETSRLRIIDDFSIQLNMDNSQPFTAS
YHVDVEPLIVRLSLRDILLVLQIVAKASELSESGKEPVKETPAEQKAKQLRGASCKSKAPSGRALSTAAQTKANQ
AVVTKGAAATKPRGRSTHEELSATLQGMRIVLIGDLHELPIVDVGVKEFTATAENWSSNLKAEAAIHTYTNVYNF
SKSSWEPLIEPWQVGLGVARDSTTGVLSVDVASAKTLDITITTATIAVASKSLDFLTTQEDVLDKPRWSDAPYRI
RNHTGFVITMHSRSPSSEESIDLRLDDGEEAPWTFEEWEKMRENILTKGAAQNDVGIKLEGSGFDTVKNVRVNRE
GEYLYSLRPKTDNVTHRLCVDVRLGSDNVKDVTLRSPLLVENATEIPVELGIYDASEGHLLKIEKIAPGDSRPAP
VGAAYEKKMIVRPDSGFGYQWSRDQLWWRDLLKRPTKQLVCTGDTGDSFYFQVHADFDKTNPLTKAYPSMKIKLS
APVTLENLLPYDFKYRIYDRNTKKDWSNFLRKGGVSPVHMVELSHLLLLSVDMQDTIFKPSDFSIINSGSNDDFR
KEKRLLVRDEQGLTLHLSLHYFKVPKSGGAFKISVYSPYVVLNKTGLDMGIRAKSFLQQAKAAAGQFPVAQTGSQ
DRPKALPFMFSFGNDEHQNRALLKVDESEWSKPQSFDAVGSTSEVVLNSSTSKHREIHLGITVKSGDGKYKMTRV
VTLAPRFVLVNKLGEEVLVRESGSSNHMTIRSGVLHPLHFMQKSAVKQLCLRFPGVDNHWTSPFNIADLGTTHVK
MARAGQRQRLVRVEILTEESTIFLHMSVEGKHWPFSMRNESDTEFSFYQANPNVDEDDDEDRSGWKPVRYRLPPR
SVMPYAWDFPAAKFREVVISTCGKERHVKLAEMGNQIPMKFAGPGGQQKIIDINVAADGPMQTLILSNFRASRSM
FKPAAVSRTNTGPEAFEVKDQGTGATMLAQLKLSGIGVSLINAHLKELAYVTLREVQLRLSDSPLIQTMSLAVKW
IQIDNQLYGGIFPIVLYPSVVPKRANEVEAHPSLHAMVSRVKDDSYGVLYIKYATVLLQQMTVDLDEDFVFALLD
FSNVPGASWTAVEGPGSGRLCDEDLDIPEPSQQQSGQDMYFEVLNIQPMQIDLSFVRTERVNAEDKTSTRNPIMF
FLNVMTMAIGNVNDAPVRFNALMLDNVRVSRAVLVQNVSSHYSQEVMYQIHKILGSADFLGNPVGLFNNISSGVT
DIFYEPYQGLILSDRPEEFGIGIARGAVSFAKKTVYGFSDSFSKFTGSLGKGLAAASLDKQFQDRRRITRARNRP
KHALYGVAAGANSLLTSVASGVGGLARKPLEGAEQEGALGFFKGVGKGVLGLATKPAVGVLDMASNVSEGIRNTT
TVFDGSELERTRLPRFMANDGIVRPYGAREALGQFWLKQVDNGKYFDEQYVGHLELPREDMVVMVTYARILLIRS
RRLTSEWDVKLKDVQTVAKERTGVSLTLRGGTNGPFIPVGGGSERGYLYRMIGVAAEEFNRRFRGAE*
Coding >Ophcf2|00644
ATGCTCGAGGGGCTCGCGGCCGGCCTGCTCAACCGCTTCTTGGGCATGTACGTCCAAAACTTCGATCCCACCCAG
CTCAAGGTCGGCATCTGGTCCGGTGACGTCAAGCTCCGCAACCTCGAGCTCCGGCGTGAGGCCCTCGATCAGCTC
AAGCTGCCCATCAACGTCGTCGAGGGCCATCTCGGCCAGCTGACGCTCATCATCCCGTGGTCCAACCTGCGAGGC
GCCCCGGTCAAGGTCTTCGTCGAAGACGTCTTCTTACTCGCTAGCCCAAAGGAAGAGGCCGAATATGATCAGAAG
GAGGAGGAGCAACGAAGCCAGCGGCTCAAGATGGAGAAGCTTGACAGCGCCGAGCTGCTCAAGGAGAAGAATCGA
GAGGGCATGAGTCCCGAAGAGCAGCAAAAGAATCAGAGCTTCACGCAGAGTCTCGTCACCAAGATCGTCGACAAC
CTGCAAATCACCGTCAAGAAGATCCACATCCGATATGAAGATTCCATTTCCGCCCCCGGCCATCCCTTCGCCCTC
GGCCTCACGCTCGAAGAGTTCTCGGCGGTCAGCACCGACGGCGACTGGAAGCCGACTTTTATACAAAACTCGACC
GTCATCACCAACAAGCTGGCCACGCTCGGAGCCTTGGCCGTGTACTGGAACACAGACACTCATCTCATGGGCAGT
GGGCGCGAAGCTGCGCTGCCGCCTGACGAGGCCATGTCCCACGAAGACATGGTGACCAAGTTTCGCTCCCTCATC
GATACGACCGCCTCATCGGACCATCAGTTCATTCTAAAACCCGTCAGCGGCCAGGCCAAGATCGAGCTCAACAAG
TCGGGCGATGTTGTGGCTCCTAAGTTCAAGGTTAACCTGTTGTTCGAGGAGATCGGTCTCGTGCTCGACGACCAC
CAATACCGCGATGCCCTGATGATGGCCGATCTGTTCCATTACTTCATCCGCCACCAGGAGTACAGAGCGCTGAAG
CCCAAGGGCGTTCGACCGAGCCAGGACCCCCGAGCTTGGTTTCGATTCGCAGGCAAGGCCGTGCTCGGCAACATC
CACGAGCGGAACCGCAAGTGGTCCTGGGACTATTTTAGGGAGCGGCGCGACGATCGCATCCGCTACATAGAACTC
TTCAAGAAGAAGAAGGAGCAGCAGCAGCTGTCGCCGGACGAAGAAGAGGATATCGTGACTCTCGAGTGGAAGCTG
GGATACGAAGACTTGCGCTTCTGGCGTTCCCTGGCCCGCAACCAGCTTAAAAAAGAAAACGCGGAGGCTTTGAAA
AGACGAGCCCAGCAGCCTGAGCAGCAGGGCTGGATGTCATGGATCTGGGGCTCGAAGCCGCAAGGAAAGATTGAG
AAGAACGAGGAAAACACTCAGATGACCGAGGAGCAGCGCAAGGAGCTGTACGACATGATTGACTGGGACGAGAAG
ACGGCACTGGCGGAGGCCATCGACGTCCCGCGCGAGGCCGTCAAGCTCTGCATCGAGGCCTGTCTCGGCACCGGG
AGCTTCACCCTCAGACAGGGCAGTCACGGAAAGGCTCCGAGAGACCTGCTCGGGTTATACTTTGACGTCTTCAAA
GCAAAGGCCCTGCAGCGCAAGGACTCGATGCTCGCCAACGTCAGTCTCGGGGGTTTAAGGGTCGAGGACGGCACG
ACACCAGACAGCCTTTACCCCGAGATTGTACGGGTCAAAGACGCTCCCGGGACGAAGCAGCGCAAGAGACTGTCC
CTAGCGGAGCTAGAGAAGAGCAGCGATGAGCCGTTCTTCCAGTTCGAGGTGGAGCAGAACCCGATCGAGCGCGAG
GGCGACATCGCCGTCATGGGCAGTCTGAAGCCCCTCGAGGTCGTGTGGAATCCCAACTTCGTCGTTGGAATCGTT
GACTTCTTCAGACCGCCCGAGAGGCACATGGAGTCCATCACGGCCCTCATGGAAACGGCCGGCGCCACCGTCGAG
GGCATCAGGGAGCAGACACGCGCCGGCCTCGAGTTCGCCCTCGAGGAGCACAAGACCATCAACGCCGAGCTGAGC
CTGCAGGCGCCGCTCATCATCGTACCAGTCAGCATCACGGCCGGGGAGTCTACGTGCGTCATCGTCGACGCTGGC
CACATCCACGTCAACAGCCAGCTGGTAGACCAGGAGACCATGAAGGAGATCCAGGCCAAGCAGCGGCAGACTTAC
AGCGAGGAGGACTTTAAGAGGCTCGAGTCGGTCATGTACGACAAATTCATCGTCAAGCTCACCTCTACCCAGGTC
CTCATCGGGCCTTCGATCGAGAAGACCAAGGCGCAGCTCACGAGGAGGAGCGAAGGCTCCCAGCTGCACGTCGTC
GAGAAGATCAACGTCGACTTTGTCGTGGAGACGTCGATCCTGCCCAAGGCCCCTAACCTGACCAAGTTCAGGGTG
TCCGGCCACATGCCAATGCTCCACGCCTCGGTTTCGGACTCCAAGTACAAGAACCTGATGAAGATCATCGATGTG
GCCATTCCCAAGCTCGGAGGTGAGAGTCGGCAGGACGAAGTGCCGGCGCTCAAGGCCGACGAGGGCGGGCATCCC
CGAGTTGCCCCGCCGCAAGAGCAGACTCGACAGCCTTCGCGACCCCGGCTCGCTAGCAGCGGCTCGAATAGGTCT
CCTGGGCGGAGGTCGCAGCGGGAGAATAGGCAGTCGGCCGGGTTTCCCTTTCTGCAGCCGCCCAGCGCCGTCGTG
CTCGACGACATGGATGATGATCAGGACGACTTCGAGGACGCCTCAGACGGTGCAGACGGGGAACAGCTCAAGATT
CAGCAGCGGAGCTTCGAGTTCAACTTCAAGGTCGATACTCTCAAAGGCTCGCTCTACCGTAGCGATCCGGACCGC
ACCAAGCCCGACGCTCTGTTGGTCGAGCTCGTGGCCGAGCGCTTCGACCTTGCCTTTTACACGAGGCTGTACGAC
ATGTCTGCCGAGGTGTCTCTCGGGGCTGTATCTGTGGACGACTTCGTCGACAATCCCCCTGCAGAGTTCAAGTCC
ATCGTCTCGTCCGGTGACAGTGATGACCTCCAGGAAGGCCGGAGTCTGGTCCACGTCAAGTACATGGATGTCAAG
CCACAGTCGCCCGAGTTTATGCCCGTTTACGAGGGAGTCAAGACGAACATCAGTGCCTCGGTGTTAACCATCAAC
CTCGTCGTGACGAGGAAGACGCTACTGACGCTCCTCGACTTCATTCTCGTCACCTTTGCCGGAGGCAACAACGAC
CAGGAACAAAGCCGAACGGCCGTCACCGATGGTCAAGGCGCCGGACACGAAGAGACGGCTACGGAGCCGGCCAAG
CAAAACGCCGACTCGGGTTCCATCAGAGTCAAGGTGGATCTGAAGGGCATCAGGCTCATCCTCAACAACGACGGC
ATAAGGTTGGCGACGCTGTCGCTCACGGAGGCCGACGCCGGCATATTCCTGCGCGGAAACACGATGCGAATATTT
GCAAAGCTCGGAGATTTGTCTCTCGTCGACGACGTCAACCTGGGCGTCTCCAGGGACTCCAACCTGCGGAGACTC
GTCACCATTCAAGGCGACGAACTCGCCGATTTCCGCTACGAGACGTTTGACGCCGACAACAAGCAGGCGTATCCG
GGCCATGACAGCGCCATCTTCCTGCGGGCCGGTTCGGTCAAGGTAAACTTCGTCGAGGAGCCGTTCCGCAAGATC
ATCGACTTCCTCGTCAAGTTCGGCAGGATGCAAGCCCTTTACAACGCTGCACGACAGGCCGCCGTGACACGGGCC
AACCAGATGCAGCAGAGTCCCAGCAGGTTCAAGTTTGACGTCGTCATCAAGACGCCCATCGTCGTCTTCCCGCGC
TTGATGGTCTCGGAGTCTCCTGAACGCGACGTCGTGACGGCATACCTGGGCGAGATCTATGCGCAGAACGAGTTT
GCGCCTCTCGATGATGGCGAGGCTTCTCGGATCGCCATGAAGATATCCACGGGCATCAGGAAGATCCGGCTTACG
TCCGACTTCAACTACGACAACGACAGATCGGAAGAGCTAGAGATGATAGATCAGGTTGACCTTGGGCTGAGCATC
ACCTATGCCGAGCACAAGCATGGCGTCATGCGCCCAGACACGGAGATCGAGGCGTCCATGTCGGACATCAAGCTC
AGGCTCACGCAGCATCAGCTCAAGTTCCTGCTGGAGATCTCCAAAGCAGTTCCTGCTGCCTTTGCTGGCGACGGC
AGCACCGGCGACGAGGACGCGGCTCAGCTCGTCGACGAGGAGACGCTGCGGCGCGCCAGAACGGCGTCGGCAGAC
CATGGTATCGGCCCTGACCAGCACGCCGTCGACCTCGGGCCCGAGTTGAAGTCGCCTACGGATACGTGGACCCAG
CTCGACTTGGTGTTCCGAGTCGACACCATCGGTCTCGAACTCATCATGGCACCGCTGGACGAGCCCGTGGGCGAC
TTGGCCGCGTCCAGCCTGTCTCGCTTCTCGCTCGACGAAACCAAGGTGAAGACGCGGATGATGTCGGATGGCTCG
CTGGAAGCCGAGTTGCTCATTCGCTCCTTGACCATCTACGACAGCCGTCCGAAAGGAGTCAACAAGTTCCGTCGC
ATCATGAGCTCTTCAAACAAAGAGTCCCAGCAACTCATGGCGAGCGTCACCATGTCGGGCGGCAAGGAGAGCAGC
ATGATCGCCATGGCGACCATCGACAGCCCTCGCGTCATCTTCGCGCTCGACTACCTCTTCGCTCTCCAGGCGTTT
GCCACCGAAGGCCTCAAGGTGGAAGATTCCAGCCCGCTGGACGATGTCAGCACCGACGAGTCACCAGAAGGCTCG
GAAGATGCCGACTCGTTGCGAGTGTCGTCCACTAAGCCTGGTCCGTCTCAGGCGACGTCTCCGCGACGCAGCGAA
TCCAGCTCCGGCGAGCCGCAGAAGCGTCAAGGCGAGGCTTCGATGAGCTTGGCCTTGCGAGTCAACCTCGTCGAC
GCGCAGGTCATACTCATCGCCAACCCGCTGAGGTCCAATTCCGAAGCCATCGTCCTGGGCATCCGACAGGTGCTT
CTATCGCAACAGAACGCACTCACGTTCCAGGTCTCCGAGATGGGCATGTTTCTATGCGTCATGGACAGGTTCGAG
ACGTCGCGCCTCAGAATCATCGACGACTTTTCGATACAGTTGAACATGGACAACTCGCAGCCATTCACGGCCAGC
TATCACGTCGATGTCGAGCCTCTCATCGTTCGACTCTCCCTGAGAGATATTCTCCTCGTGCTCCAGATCGTCGCC
AAAGCCAGCGAGCTCTCGGAAAGCGGGAAAGAGCCGGTCAAAGAGACGCCGGCGGAGCAAAAGGCGAAGCAGCTC
AGAGGCGCCAGCTGCAAGTCAAAGGCCCCCAGCGGCCGCGCCCTGTCGACGGCGGCTCAGACCAAGGCCAACCAG
GCCGTTGTCACCAAAGGAGCCGCGGCGACAAAGCCACGCGGCAGAAGCACGCATGAGGAGCTCTCTGCGACGCTT
CAGGGCATGCGGATCGTGCTGATCGGAGACCTGCACGAGCTGCCCATCGTCGACGTCGGAGTCAAGGAGTTTACG
GCCACGGCAGAGAACTGGTCGTCGAATCTGAAAGCCGAGGCGGCCATACACACGTACACGAACGTCTACAACTTT
TCGAAATCCAGCTGGGAGCCCCTGATCGAACCATGGCAGGTCGGCCTGGGCGTGGCCAGAGACTCGACCACGGGC
GTACTGTCGGTCGACGTGGCCTCGGCCAAGACGCTGGATATCACGATCACGACGGCGACCATCGCAGTGGCTTCC
AAGTCGCTCGACTTTCTCACGACGCAGGAAGACGTCTTGGACAAACCAAGGTGGAGCGACGCGCCTTACCGCATC
AGAAACCACACTGGATTCGTCATCACGATGCACTCGCGAAGCCCAAGCAGCGAAGAGTCCATCGACCTGCGGCTC
GACGACGGAGAGGAGGCACCGTGGACCTTTGAAGAATGGGAGAAGATGCGCGAGAACATCCTGACCAAAGGCGCC
GCCCAGAATGACGTGGGCATCAAGTTGGAGGGCAGCGGCTTCGACACCGTGAAGAACGTGCGGGTGAACCGAGAG
GGCGAGTATCTCTACAGCCTGCGGCCCAAGACGGACAACGTGACGCATCGGCTGTGCGTCGACGTACGTCTCGGG
TCTGACAATGTCAAGGACGTGACGCTACGATCTCCGCTGCTCGTCGAGAACGCGACGGAGATCCCGGTCGAGCTC
GGCATCTACGACGCTTCAGAGGGTCACCTTCTCAAGATCGAGAAGATCGCTCCCGGGGACTCGCGTCCGGCCCCG
GTCGGCGCCGCGTACGAAAAGAAGATGATTGTGCGTCCGGACAGCGGCTTCGGCTATCAGTGGAGCAGAGACCAG
CTCTGGTGGAGGGATCTGCTCAAGCGACCGACCAAGCAGCTCGTCTGCACGGGGGATACCGGCGATTCGTTCTAC
TTTCAGGTCCACGCGGACTTTGACAAGACCAACCCATTGACCAAGGCATATCCGTCGATGAAGATCAAGCTCTCG
GCTCCGGTGACGCTGGAAAACCTGTTGCCGTACGACTTCAAGTACAGGATCTACGACAGGAACACCAAGAAGGAC
TGGTCCAACTTTCTGAGAAAGGGCGGCGTGAGCCCCGTCCACATGGTGGAGCTCTCTCATCTCCTACTCCTGAGC
GTCGATATGCAGGACACCATCTTCAAGCCGAGCGACTTCTCCATCATCAACTCCGGAAGCAACGACGACTTCCGC
AAGGAGAAGCGGCTCCTGGTCAGGGACGAGCAAGGCCTGACGCTGCACCTCAGCCTCCACTACTTCAAAGTGCCC
AAGAGCGGCGGCGCGTTCAAGATCAGCGTGTACAGCCCCTACGTCGTGTTGAACAAGACGGGTCTCGACATGGGG
ATCCGCGCCAAGAGCTTCCTACAGCAGGCCAAGGCGGCGGCCGGTCAGTTCCCCGTGGCGCAGACGGGAAGCCAA
GATAGGCCGAAGGCGCTGCCGTTCATGTTCTCGTTCGGAAACGACGAGCATCAGAACCGGGCGCTGCTCAAGGTG
GACGAGTCGGAGTGGAGCAAGCCGCAGAGCTTCGACGCCGTGGGGAGCACGTCGGAAGTGGTGCTGAACTCGTCG
ACGTCGAAGCATAGGGAGATTCACCTGGGCATCACGGTCAAGTCGGGAGACGGCAAGTACAAGATGACGCGGGTC
GTGACGCTGGCGCCGCGCTTCGTGCTGGTCAACAAGCTGGGCGAGGAGGTTCTGGTGCGAGAGTCGGGCTCGTCG
AACCACATGACCATCAGATCCGGAGTTCTGCATCCGCTGCATTTCATGCAGAAGTCGGCGGTCAAGCAGCTGTGC
CTGCGCTTCCCGGGCGTCGACAACCACTGGACGTCGCCCTTCAACATCGCCGATCTCGGGACTACGCACGTCAAG
ATGGCCAGGGCCGGACAGCGGCAGCGGCTGGTGCGGGTCGAGATACTCACGGAGGAGTCGACCATCTTCTTGCAC
ATGAGCGTCGAGGGAAAGCACTGGCCCTTTTCCATGCGTAACGAGAGCGACACCGAGTTCTCCTTTTACCAGGCC
AACCCCAACGTCGACGAGGACGACGACGAGGACCGAAGCGGGTGGAAGCCGGTGCGGTACCGGCTGCCGCCTCGG
AGCGTGATGCCGTACGCCTGGGACTTTCCGGCTGCCAAGTTCCGCGAGGTGGTGATTTCTACATGCGGCAAGGAG
CGTCACGTCAAGCTGGCCGAGATGGGCAATCAGATCCCGATGAAGTTTGCCGGACCCGGCGGGCAGCAGAAGATC
ATCGACATCAACGTGGCTGCCGACGGGCCGATGCAGACGCTGATCCTCAGCAACTTCCGGGCCAGCAGGAGCATG
TTCAAGCCGGCAGCGGTGTCGAGGACCAACACGGGGCCCGAGGCGTTCGAGGTCAAGGACCAGGGCACCGGGGCC
ACCATGTTGGCGCAGCTCAAGCTGTCGGGCATCGGCGTCTCGCTCATCAACGCGCACCTCAAGGAGCTGGCGTAC
GTGACGCTTCGCGAGGTGCAGCTACGGCTCAGCGACTCGCCGCTGATACAGACCATGTCGCTGGCGGTCAAGTGG
ATTCAGATAGACAACCAGCTCTACGGCGGCATCTTCCCCATCGTGCTATACCCGAGCGTTGTGCCCAAGCGGGCC
AACGAGGTCGAGGCGCACCCGTCGCTGCACGCCATGGTCAGCCGGGTCAAGGACGACTCGTACGGGGTGCTGTAC
ATCAAGTACGCGACGGTGCTGCTGCAGCAGATGACGGTGGACCTGGACGAGGACTTCGTCTTTGCCCTGCTCGAC
TTCTCCAACGTTCCGGGCGCCAGCTGGACGGCGGTCGAAGGGCCCGGGTCCGGCCGGCTCTGCGACGAGGACCTC
GACATCCCCGAGCCGTCGCAGCAGCAGTCCGGGCAGGACATGTACTTTGAGGTGCTCAACATCCAGCCGATGCAG
ATCGACCTGAGCTTCGTGCGGACGGAGCGGGTCAACGCCGAGGATAAGACGTCGACGCGGAACCCAATCATGTTC
TTCCTCAACGTCATGACCATGGCCATTGGCAACGTCAACGACGCGCCCGTCCGCTTCAACGCCCTGATGCTGGAC
AATGTGAGGGTGTCGCGGGCGGTGCTGGTGCAGAACGTGTCGAGCCACTACAGCCAAGAGGTCATGTATCAGATC
CACAAGATACTGGGCTCGGCCGACTTCCTGGGTAACCCTGTCGGGCTGTTCAACAACATCTCGTCGGGCGTGACG
GACATCTTCTACGAGCCGTACCAGGGGCTCATCCTTTCGGACCGGCCCGAGGAGTTTGGCATCGGCATCGCGCGC
GGAGCCGTCTCGTTCGCCAAGAAGACGGTATACGGCTTCAGCGACAGCTTCTCCAAGTTTACGGGCAGCCTGGGC
AAGGGCCTGGCGGCGGCATCGCTGGACAAGCAGTTCCAGGACCGGCGGCGGATCACGAGGGCTCGCAACCGGCCC
AAGCACGCGCTGTACGGGGTGGCGGCCGGTGCCAACTCGCTGCTGACGAGCGTGGCGTCGGGGGTCGGGGGTTTG
GCGCGCAAGCCGCTCGAGGGCGCCGAGCAAGAGGGCGCCCTGGGCTTCTTCAAGGGCGTGGGCAAGGGCGTGCTC
GGGCTGGCGACGAAGCCGGCGGTAGGGGTGCTGGACATGGCCAGCAACGTCAGCGAGGGCATCCGCAACACGACG
ACGGTCTTTGACGGATCGGAGCTGGAGAGAACGCGGCTTCCGCGCTTCATGGCCAACGACGGCATCGTGCGGCCG
TACGGGGCGCGAGAGGCGCTGGGTCAGTTCTGGCTGAAGCAGGTCGACAACGGCAAGTACTTTGACGAGCAGTAC
GTCGGCCACCTGGAGCTGCCTCGCGAGGACATGGTGGTCATGGTGACGTACGCGCGCATCCTGCTGATCCGGTCT
CGGCGCCTGACGAGCGAGTGGGACGTCAAGCTCAAAGACGTGCAGACGGTGGCCAAGGAGAGGACGGGCGTGAGC
CTGACGCTGCGGGGGGGCACCAACGGGCCGTTCATCCCGGTGGGCGGCGGCAGCGAGCGGGGATATCTGTACCGG
ATGATTGGCGTGGCGGCCGAGGAATTCAATCGGCGTTTCCGGGGCGCCGAGTGA
Transcript >Ophcf2|00644
ATGCTCGAGGGGCTCGCGGCCGGCCTGCTCAACCGCTTCTTGGGCATGTACGTCCAAAACTTCGATCCCACCCAG
CTCAAGGTCGGCATCTGGTCCGGTGACGTCAAGCTCCGCAACCTCGAGCTCCGGCGTGAGGCCCTCGATCAGCTC
AAGCTGCCCATCAACGTCGTCGAGGGCCATCTCGGCCAGCTGACGCTCATCATCCCGTGGTCCAACCTGCGAGGC
GCCCCGGTCAAGGTCTTCGTCGAAGACGTCTTCTTACTCGCTAGCCCAAAGGAAGAGGCCGAATATGATCAGAAG
GAGGAGGAGCAACGAAGCCAGCGGCTCAAGATGGAGAAGCTTGACAGCGCCGAGCTGCTCAAGGAGAAGAATCGA
GAGGGCATGAGTCCCGAAGAGCAGCAAAAGAATCAGAGCTTCACGCAGAGTCTCGTCACCAAGATCGTCGACAAC
CTGCAAATCACCGTCAAGAAGATCCACATCCGATATGAAGATTCCATTTCCGCCCCCGGCCATCCCTTCGCCCTC
GGCCTCACGCTCGAAGAGTTCTCGGCGGTCAGCACCGACGGCGACTGGAAGCCGACTTTTATACAAAACTCGACC
GTCATCACCAACAAGCTGGCCACGCTCGGAGCCTTGGCCGTGTACTGGAACACAGACACTCATCTCATGGGCAGT
GGGCGCGAAGCTGCGCTGCCGCCTGACGAGGCCATGTCCCACGAAGACATGGTGACCAAGTTTCGCTCCCTCATC
GATACGACCGCCTCATCGGACCATCAGTTCATTCTAAAACCCGTCAGCGGCCAGGCCAAGATCGAGCTCAACAAG
TCGGGCGATGTTGTGGCTCCTAAGTTCAAGGTTAACCTGTTGTTCGAGGAGATCGGTCTCGTGCTCGACGACCAC
CAATACCGCGATGCCCTGATGATGGCCGATCTGTTCCATTACTTCATCCGCCACCAGGAGTACAGAGCGCTGAAG
CCCAAGGGCGTTCGACCGAGCCAGGACCCCCGAGCTTGGTTTCGATTCGCAGGCAAGGCCGTGCTCGGCAACATC
CACGAGCGGAACCGCAAGTGGTCCTGGGACTATTTTAGGGAGCGGCGCGACGATCGCATCCGCTACATAGAACTC
TTCAAGAAGAAGAAGGAGCAGCAGCAGCTGTCGCCGGACGAAGAAGAGGATATCGTGACTCTCGAGTGGAAGCTG
GGATACGAAGACTTGCGCTTCTGGCGTTCCCTGGCCCGCAACCAGCTTAAAAAAGAAAACGCGGAGGCTTTGAAA
AGACGAGCCCAGCAGCCTGAGCAGCAGGGCTGGATGTCATGGATCTGGGGCTCGAAGCCGCAAGGAAAGATTGAG
AAGAACGAGGAAAACACTCAGATGACCGAGGAGCAGCGCAAGGAGCTGTACGACATGATTGACTGGGACGAGAAG
ACGGCACTGGCGGAGGCCATCGACGTCCCGCGCGAGGCCGTCAAGCTCTGCATCGAGGCCTGTCTCGGCACCGGG
AGCTTCACCCTCAGACAGGGCAGTCACGGAAAGGCTCCGAGAGACCTGCTCGGGTTATACTTTGACGTCTTCAAA
GCAAAGGCCCTGCAGCGCAAGGACTCGATGCTCGCCAACGTCAGTCTCGGGGGTTTAAGGGTCGAGGACGGCACG
ACACCAGACAGCCTTTACCCCGAGATTGTACGGGTCAAAGACGCTCCCGGGACGAAGCAGCGCAAGAGACTGTCC
CTAGCGGAGCTAGAGAAGAGCAGCGATGAGCCGTTCTTCCAGTTCGAGGTGGAGCAGAACCCGATCGAGCGCGAG
GGCGACATCGCCGTCATGGGCAGTCTGAAGCCCCTCGAGGTCGTGTGGAATCCCAACTTCGTCGTTGGAATCGTT
GACTTCTTCAGACCGCCCGAGAGGCACATGGAGTCCATCACGGCCCTCATGGAAACGGCCGGCGCCACCGTCGAG
GGCATCAGGGAGCAGACACGCGCCGGCCTCGAGTTCGCCCTCGAGGAGCACAAGACCATCAACGCCGAGCTGAGC
CTGCAGGCGCCGCTCATCATCGTACCAGTCAGCATCACGGCCGGGGAGTCTACGTGCGTCATCGTCGACGCTGGC
CACATCCACGTCAACAGCCAGCTGGTAGACCAGGAGACCATGAAGGAGATCCAGGCCAAGCAGCGGCAGACTTAC
AGCGAGGAGGACTTTAAGAGGCTCGAGTCGGTCATGTACGACAAATTCATCGTCAAGCTCACCTCTACCCAGGTC
CTCATCGGGCCTTCGATCGAGAAGACCAAGGCGCAGCTCACGAGGAGGAGCGAAGGCTCCCAGCTGCACGTCGTC
GAGAAGATCAACGTCGACTTTGTCGTGGAGACGTCGATCCTGCCCAAGGCCCCTAACCTGACCAAGTTCAGGGTG
TCCGGCCACATGCCAATGCTCCACGCCTCGGTTTCGGACTCCAAGTACAAGAACCTGATGAAGATCATCGATGTG
GCCATTCCCAAGCTCGGAGGTGAGAGTCGGCAGGACGAAGTGCCGGCGCTCAAGGCCGACGAGGGCGGGCATCCC
CGAGTTGCCCCGCCGCAAGAGCAGACTCGACAGCCTTCGCGACCCCGGCTCGCTAGCAGCGGCTCGAATAGGTCT
CCTGGGCGGAGGTCGCAGCGGGAGAATAGGCAGTCGGCCGGGTTTCCCTTTCTGCAGCCGCCCAGCGCCGTCGTG
CTCGACGACATGGATGATGATCAGGACGACTTCGAGGACGCCTCAGACGGTGCAGACGGGGAACAGCTCAAGATT
CAGCAGCGGAGCTTCGAGTTCAACTTCAAGGTCGATACTCTCAAAGGCTCGCTCTACCGTAGCGATCCGGACCGC
ACCAAGCCCGACGCTCTGTTGGTCGAGCTCGTGGCCGAGCGCTTCGACCTTGCCTTTTACACGAGGCTGTACGAC
ATGTCTGCCGAGGTGTCTCTCGGGGCTGTATCTGTGGACGACTTCGTCGACAATCCCCCTGCAGAGTTCAAGTCC
ATCGTCTCGTCCGGTGACAGTGATGACCTCCAGGAAGGCCGGAGTCTGGTCCACGTCAAGTACATGGATGTCAAG
CCACAGTCGCCCGAGTTTATGCCCGTTTACGAGGGAGTCAAGACGAACATCAGTGCCTCGGTGTTAACCATCAAC
CTCGTCGTGACGAGGAAGACGCTACTGACGCTCCTCGACTTCATTCTCGTCACCTTTGCCGGAGGCAACAACGAC
CAGGAACAAAGCCGAACGGCCGTCACCGATGGTCAAGGCGCCGGACACGAAGAGACGGCTACGGAGCCGGCCAAG
CAAAACGCCGACTCGGGTTCCATCAGAGTCAAGGTGGATCTGAAGGGCATCAGGCTCATCCTCAACAACGACGGC
ATAAGGTTGGCGACGCTGTCGCTCACGGAGGCCGACGCCGGCATATTCCTGCGCGGAAACACGATGCGAATATTT
GCAAAGCTCGGAGATTTGTCTCTCGTCGACGACGTCAACCTGGGCGTCTCCAGGGACTCCAACCTGCGGAGACTC
GTCACCATTCAAGGCGACGAACTCGCCGATTTCCGCTACGAGACGTTTGACGCCGACAACAAGCAGGCGTATCCG
GGCCATGACAGCGCCATCTTCCTGCGGGCCGGTTCGGTCAAGGTAAACTTCGTCGAGGAGCCGTTCCGCAAGATC
ATCGACTTCCTCGTCAAGTTCGGCAGGATGCAAGCCCTTTACAACGCTGCACGACAGGCCGCCGTGACACGGGCC
AACCAGATGCAGCAGAGTCCCAGCAGGTTCAAGTTTGACGTCGTCATCAAGACGCCCATCGTCGTCTTCCCGCGC
TTGATGGTCTCGGAGTCTCCTGAACGCGACGTCGTGACGGCATACCTGGGCGAGATCTATGCGCAGAACGAGTTT
GCGCCTCTCGATGATGGCGAGGCTTCTCGGATCGCCATGAAGATATCCACGGGCATCAGGAAGATCCGGCTTACG
TCCGACTTCAACTACGACAACGACAGATCGGAAGAGCTAGAGATGATAGATCAGGTTGACCTTGGGCTGAGCATC
ACCTATGCCGAGCACAAGCATGGCGTCATGCGCCCAGACACGGAGATCGAGGCGTCCATGTCGGACATCAAGCTC
AGGCTCACGCAGCATCAGCTCAAGTTCCTGCTGGAGATCTCCAAAGCAGTTCCTGCTGCCTTTGCTGGCGACGGC
AGCACCGGCGACGAGGACGCGGCTCAGCTCGTCGACGAGGAGACGCTGCGGCGCGCCAGAACGGCGTCGGCAGAC
CATGGTATCGGCCCTGACCAGCACGCCGTCGACCTCGGGCCCGAGTTGAAGTCGCCTACGGATACGTGGACCCAG
CTCGACTTGGTGTTCCGAGTCGACACCATCGGTCTCGAACTCATCATGGCACCGCTGGACGAGCCCGTGGGCGAC
TTGGCCGCGTCCAGCCTGTCTCGCTTCTCGCTCGACGAAACCAAGGTGAAGACGCGGATGATGTCGGATGGCTCG
CTGGAAGCCGAGTTGCTCATTCGCTCCTTGACCATCTACGACAGCCGTCCGAAAGGAGTCAACAAGTTCCGTCGC
ATCATGAGCTCTTCAAACAAAGAGTCCCAGCAACTCATGGCGAGCGTCACCATGTCGGGCGGCAAGGAGAGCAGC
ATGATCGCCATGGCGACCATCGACAGCCCTCGCGTCATCTTCGCGCTCGACTACCTCTTCGCTCTCCAGGCGTTT
GCCACCGAAGGCCTCAAGGTGGAAGATTCCAGCCCGCTGGACGATGTCAGCACCGACGAGTCACCAGAAGGCTCG
GAAGATGCCGACTCGTTGCGAGTGTCGTCCACTAAGCCTGGTCCGTCTCAGGCGACGTCTCCGCGACGCAGCGAA
TCCAGCTCCGGCGAGCCGCAGAAGCGTCAAGGCGAGGCTTCGATGAGCTTGGCCTTGCGAGTCAACCTCGTCGAC
GCGCAGGTCATACTCATCGCCAACCCGCTGAGGTCCAATTCCGAAGCCATCGTCCTGGGCATCCGACAGGTGCTT
CTATCGCAACAGAACGCACTCACGTTCCAGGTCTCCGAGATGGGCATGTTTCTATGCGTCATGGACAGGTTCGAG
ACGTCGCGCCTCAGAATCATCGACGACTTTTCGATACAGTTGAACATGGACAACTCGCAGCCATTCACGGCCAGC
TATCACGTCGATGTCGAGCCTCTCATCGTTCGACTCTCCCTGAGAGATATTCTCCTCGTGCTCCAGATCGTCGCC
AAAGCCAGCGAGCTCTCGGAAAGCGGGAAAGAGCCGGTCAAAGAGACGCCGGCGGAGCAAAAGGCGAAGCAGCTC
AGAGGCGCCAGCTGCAAGTCAAAGGCCCCCAGCGGCCGCGCCCTGTCGACGGCGGCTCAGACCAAGGCCAACCAG
GCCGTTGTCACCAAAGGAGCCGCGGCGACAAAGCCACGCGGCAGAAGCACGCATGAGGAGCTCTCTGCGACGCTT
CAGGGCATGCGGATCGTGCTGATCGGAGACCTGCACGAGCTGCCCATCGTCGACGTCGGAGTCAAGGAGTTTACG
GCCACGGCAGAGAACTGGTCGTCGAATCTGAAAGCCGAGGCGGCCATACACACGTACACGAACGTCTACAACTTT
TCGAAATCCAGCTGGGAGCCCCTGATCGAACCATGGCAGGTCGGCCTGGGCGTGGCCAGAGACTCGACCACGGGC
GTACTGTCGGTCGACGTGGCCTCGGCCAAGACGCTGGATATCACGATCACGACGGCGACCATCGCAGTGGCTTCC
AAGTCGCTCGACTTTCTCACGACGCAGGAAGACGTCTTGGACAAACCAAGGTGGAGCGACGCGCCTTACCGCATC
AGAAACCACACTGGATTCGTCATCACGATGCACTCGCGAAGCCCAAGCAGCGAAGAGTCCATCGACCTGCGGCTC
GACGACGGAGAGGAGGCACCGTGGACCTTTGAAGAATGGGAGAAGATGCGCGAGAACATCCTGACCAAAGGCGCC
GCCCAGAATGACGTGGGCATCAAGTTGGAGGGCAGCGGCTTCGACACCGTGAAGAACGTGCGGGTGAACCGAGAG
GGCGAGTATCTCTACAGCCTGCGGCCCAAGACGGACAACGTGACGCATCGGCTGTGCGTCGACGTACGTCTCGGG
TCTGACAATGTCAAGGACGTGACGCTACGATCTCCGCTGCTCGTCGAGAACGCGACGGAGATCCCGGTCGAGCTC
GGCATCTACGACGCTTCAGAGGGTCACCTTCTCAAGATCGAGAAGATCGCTCCCGGGGACTCGCGTCCGGCCCCG
GTCGGCGCCGCGTACGAAAAGAAGATGATTGTGCGTCCGGACAGCGGCTTCGGCTATCAGTGGAGCAGAGACCAG
CTCTGGTGGAGGGATCTGCTCAAGCGACCGACCAAGCAGCTCGTCTGCACGGGGGATACCGGCGATTCGTTCTAC
TTTCAGGTCCACGCGGACTTTGACAAGACCAACCCATTGACCAAGGCATATCCGTCGATGAAGATCAAGCTCTCG
GCTCCGGTGACGCTGGAAAACCTGTTGCCGTACGACTTCAAGTACAGGATCTACGACAGGAACACCAAGAAGGAC
TGGTCCAACTTTCTGAGAAAGGGCGGCGTGAGCCCCGTCCACATGGTGGAGCTCTCTCATCTCCTACTCCTGAGC
GTCGATATGCAGGACACCATCTTCAAGCCGAGCGACTTCTCCATCATCAACTCCGGAAGCAACGACGACTTCCGC
AAGGAGAAGCGGCTCCTGGTCAGGGACGAGCAAGGCCTGACGCTGCACCTCAGCCTCCACTACTTCAAAGTGCCC
AAGAGCGGCGGCGCGTTCAAGATCAGCGTGTACAGCCCCTACGTCGTGTTGAACAAGACGGGTCTCGACATGGGG
ATCCGCGCCAAGAGCTTCCTACAGCAGGCCAAGGCGGCGGCCGGTCAGTTCCCCGTGGCGCAGACGGGAAGCCAA
GATAGGCCGAAGGCGCTGCCGTTCATGTTCTCGTTCGGAAACGACGAGCATCAGAACCGGGCGCTGCTCAAGGTG
GACGAGTCGGAGTGGAGCAAGCCGCAGAGCTTCGACGCCGTGGGGAGCACGTCGGAAGTGGTGCTGAACTCGTCG
ACGTCGAAGCATAGGGAGATTCACCTGGGCATCACGGTCAAGTCGGGAGACGGCAAGTACAAGATGACGCGGGTC
GTGACGCTGGCGCCGCGCTTCGTGCTGGTCAACAAGCTGGGCGAGGAGGTTCTGGTGCGAGAGTCGGGCTCGTCG
AACCACATGACCATCAGATCCGGAGTTCTGCATCCGCTGCATTTCATGCAGAAGTCGGCGGTCAAGCAGCTGTGC
CTGCGCTTCCCGGGCGTCGACAACCACTGGACGTCGCCCTTCAACATCGCCGATCTCGGGACTACGCACGTCAAG
ATGGCCAGGGCCGGACAGCGGCAGCGGCTGGTGCGGGTCGAGATACTCACGGAGGAGTCGACCATCTTCTTGCAC
ATGAGCGTCGAGGGAAAGCACTGGCCCTTTTCCATGCGTAACGAGAGCGACACCGAGTTCTCCTTTTACCAGGCC
AACCCCAACGTCGACGAGGACGACGACGAGGACCGAAGCGGGTGGAAGCCGGTGCGGTACCGGCTGCCGCCTCGG
AGCGTGATGCCGTACGCCTGGGACTTTCCGGCTGCCAAGTTCCGCGAGGTGGTGATTTCTACATGCGGCAAGGAG
CGTCACGTCAAGCTGGCCGAGATGGGCAATCAGATCCCGATGAAGTTTGCCGGACCCGGCGGGCAGCAGAAGATC
ATCGACATCAACGTGGCTGCCGACGGGCCGATGCAGACGCTGATCCTCAGCAACTTCCGGGCCAGCAGGAGCATG
TTCAAGCCGGCAGCGGTGTCGAGGACCAACACGGGGCCCGAGGCGTTCGAGGTCAAGGACCAGGGCACCGGGGCC
ACCATGTTGGCGCAGCTCAAGCTGTCGGGCATCGGCGTCTCGCTCATCAACGCGCACCTCAAGGAGCTGGCGTAC
GTGACGCTTCGCGAGGTGCAGCTACGGCTCAGCGACTCGCCGCTGATACAGACCATGTCGCTGGCGGTCAAGTGG
ATTCAGATAGACAACCAGCTCTACGGCGGCATCTTCCCCATCGTGCTATACCCGAGCGTTGTGCCCAAGCGGGCC
AACGAGGTCGAGGCGCACCCGTCGCTGCACGCCATGGTCAGCCGGGTCAAGGACGACTCGTACGGGGTGCTGTAC
ATCAAGTACGCGACGGTGCTGCTGCAGCAGATGACGGTGGACCTGGACGAGGACTTCGTCTTTGCCCTGCTCGAC
TTCTCCAACGTTCCGGGCGCCAGCTGGACGGCGGTCGAAGGGCCCGGGTCCGGCCGGCTCTGCGACGAGGACCTC
GACATCCCCGAGCCGTCGCAGCAGCAGTCCGGGCAGGACATGTACTTTGAGGTGCTCAACATCCAGCCGATGCAG
ATCGACCTGAGCTTCGTGCGGACGGAGCGGGTCAACGCCGAGGATAAGACGTCGACGCGGAACCCAATCATGTTC
TTCCTCAACGTCATGACCATGGCCATTGGCAACGTCAACGACGCGCCCGTCCGCTTCAACGCCCTGATGCTGGAC
AATGTGAGGGTGTCGCGGGCGGTGCTGGTGCAGAACGTGTCGAGCCACTACAGCCAAGAGGTCATGTATCAGATC
CACAAGATACTGGGCTCGGCCGACTTCCTGGGTAACCCTGTCGGGCTGTTCAACAACATCTCGTCGGGCGTGACG
GACATCTTCTACGAGCCGTACCAGGGGCTCATCCTTTCGGACCGGCCCGAGGAGTTTGGCATCGGCATCGCGCGC
GGAGCCGTCTCGTTCGCCAAGAAGACGGTATACGGCTTCAGCGACAGCTTCTCCAAGTTTACGGGCAGCCTGGGC
AAGGGCCTGGCGGCGGCATCGCTGGACAAGCAGTTCCAGGACCGGCGGCGGATCACGAGGGCTCGCAACCGGCCC
AAGCACGCGCTGTACGGGGTGGCGGCCGGTGCCAACTCGCTGCTGACGAGCGTGGCGTCGGGGGTCGGGGGTTTG
GCGCGCAAGCCGCTCGAGGGCGCCGAGCAAGAGGGCGCCCTGGGCTTCTTCAAGGGCGTGGGCAAGGGCGTGCTC
GGGCTGGCGACGAAGCCGGCGGTAGGGGTGCTGGACATGGCCAGCAACGTCAGCGAGGGCATCCGCAACACGACG
ACGGTCTTTGACGGATCGGAGCTGGAGAGAACGCGGCTTCCGCGCTTCATGGCCAACGACGGCATCGTGCGGCCG
TACGGGGCGCGAGAGGCGCTGGGTCAGTTCTGGCTGAAGCAGGTCGACAACGGCAAGTACTTTGACGAGCAGTAC
GTCGGCCACCTGGAGCTGCCTCGCGAGGACATGGTGGTCATGGTGACGTACGCGCGCATCCTGCTGATCCGGTCT
CGGCGCCTGACGAGCGAGTGGGACGTCAAGCTCAAAGACGTGCAGACGGTGGCCAAGGAGAGGACGGGCGTGAGC
CTGACGCTGCGGGGGGGCACCAACGGGCCGTTCATCCCGGTGGGCGGCGGCAGCGAGCGGGGATATCTGTACCGG
ATGATTGGCGTGGCGGCCGAGGAATTCAATCGGCGTTTCCGGGGCGCCGAGTGA
Gene >Ophcf2|00644
ATGCTCGAGGGGCTCGCGGCCGGCCTGCTCAACCGCTTCTTGGGCATGTACGTCCAAAACTTCGATCCCACCCAG
CTCAAGGTCGGCATCTGGTCCGGTGACGTCAAGCTCCGCAACCTCGAGCTCCGGCGTGAGGCCCTCGATCAGCTC
AAGCTGCCCATCAACGTCGTCGAGGGCCATCTCGGCCAGCTGACGCTCATCATCCCGTGGTCCAACCTGCGAGGC
GCCCCGGTCAAGGTCTTCGTCGAAGACGTCTTCTTACTCGCTAGCCCAAAGGAAGAGGCCGAATATGATCAGAAG
GAGGAGGAGCAACGAAGCCAGCGGCTCAAGATGGAGAAGCTTGACAGCGCCGAGCTGCTCAAGGAGAAGAATCGA
GAGGGCATGAGTCCCGAAGAGCAGCAAAAGAATCAGAGCTTCACGCAGAGTCTCGTCACCAAGATCGTCGACAAC
CTGCAAATCACCGTCAAGAAGATCCACATCCGATATGAAGATTCCATTTCCGCCCCCGGCCATCCCTTCGCCCTC
GGCCTCACGCTCGAAGAGTTCTCGGCGGTCAGCACCGACGGCGACTGGAAGCCGACTTTTATACAAAACTCGACC
GTCATCACCAACAAGCTGGCCACGCTCGGAGCCTTGGCCGTGTACTGGAACACAGACACTCATCTCATGGGCAGT
GGGCGCGAAGCTGCGCTGCCGCCTGACGAGGCCATGTCCCACGAAGACATGGTGACCAAGTTTCGCTCCCTCATC
GATACGACCGCCTCATCGGACCATCAGTTCATTCTAAAACCCGTCAGCGGCCAGGCCAAGATCGAGCTCAACAAG
TCGGGCGATGTTGTGGCTCCTAAGTTCAAGGTTAACCTGTTGTTCGAGGAGATCGGTCTCGTGCTCGACGACCAC
CAATACCGCGATGCCCTGATGATGGCCGATCTGTTCCATTACTTCATCCGCCACCAGGAGTACAGAGCGCTGAAG
CCCAAGGGCGTTCGACCGAGCCAGGACCCCCGAGCTTGGTTTCGATTCGCAGGCAAGGCCGTGCTCGGCAACATC
CACGAGCGGAACCGCAAGTGGTCCTGGGACTATTTTAGGGAGCGGCGCGACGATCGCATCCGCTACATAGAACTC
TTCAAGAAGAAGAAGGAGCAGCAGCAGCTGTCGCCGGACGAAGAAGAGGATATCGTGACTCTCGAGTGGAAGCTG
GGATACGAAGACTTGCGCTTCTGGCGTTCCCTGGCCCGCAACCAGCTTAAAAAAGAAAACGCGGAGGCTTTGAAA
AGACGAGCCCAGCAGCCTGAGCAGCAGGGCTGGATGTCATGGATCTGGGGCTCGAAGCCGCAAGGAAAGATTGAG
AAGAACGAGGAAAACACTCAGATGACCGAGGAGCAGCGCAAGGAGCTGTACGACATGATTGACTGGGACGAGAAG
ACGGCACTGGCGGAGGCCATCGACGTCCCGCGCGAGGCCGTCAAGCTCTGCATCGAGGCCTGTCTCGGCACCGGG
AGCTTCACCCTCAGACAGGGCAGTCACGGAAAGGCTCCGAGAGACCTGCTCGGGTTATACTTTGACGTCTTCAAA
GCAAAGGCCCTGCAGCGCAAGGACTCGATGCTCGCCAACGTCAGTCTCGGGGGTTTAAGGGTCGAGGACGGCACG
ACACCAGACAGCCTTTACCCCGAGATTGTACGGGTCAAAGACGCTCCCGGGACGAAGCAGCGCAAGAGACTGTCC
CTAGCGGAGCTAGAGAAGAGCAGCGATGAGCCGTTCTTCCAGTTCGAGGTGGAGCAGAACCCGATCGAGCGCGAG
GGCGACATCGCCGTCATGGGCAGTCTGAAGCCCCTCGAGGTCGTGTGGAATCCCAACTTCGTCGTTGGAATCGTT
GACTTCTTCAGACCGCCCGAGAGGCACATGGAGTCCATCACGGCCCTCATGGAAACGGCCGGCGCCACCGTCGAG
GGCATCAGGGAGCAGACACGCGCCGGCCTCGAGTTCGCCCTCGAGGAGCACAAGACCATCAACGCCGAGCTGAGC
CTGCAGGCGCCGCTCATCATCGTACCAGTCAGCATCACGGCCGGGGAGTCTACGTGCGTCATCGTCGACGCTGGC
CACATCCACGTCAACAGCCAGCTGGTAGACCAGGAGACCATGAAGGAGATCCAGGCCAAGCAGCGGCAGACTTAC
AGCGAGGAGGACTTTAAGAGGCTCGAGTCGGTCATGTACGACAAATTCATCGTCAAGCTCACCTCTACCCAGGTC
CTCATCGGGCCTTCGATCGAGAAGACCAAGGCGCAGCTCACGAGGAGGAGCGAAGGCTCCCAGCTGCACGTCGTC
GAGAAGATCAACGTCGACTTTGTCGTGGAGACGTCGATCCTGCCCAAGGCCCCTAACCTGACCAAGTTCAGGGTG
TCCGGCCACATGCCAATGCTCCACGCCTCGGTTTCGGACTCCAAGTACAAGAACCTGATGAAGATCATCGATGTG
GCCATTCCCAAGCTCGGAGGTGAGAGTCGGCAGGACGAAGTGCCGGCGCTCAAGGCCGACGAGGGCGGGCATCCC
CGAGTTGCCCCGCCGCAAGAGCAGACTCGACAGCCTTCGCGACCCCGGCTCGCTAGCAGCGGCTCGAATAGGTCT
CCTGGGCGGAGGTCGCAGCGGGAGAATAGGCAGTCGGCCGGGTTTCCCTTTCTGCAGCCGCCCAGCGCCGTCGTG
CTCGACGACATGGATGATGATCAGGACGACTTCGAGGACGCCTCAGACGGTGCAGACGGGGAACAGCTCAAGATT
CAGCAGCGGAGCTTCGAGTTCAACTTCAAGGTCGATACTCTCAAAGGCTCGCTCTACCGTAGCGATCCGGACCGC
ACCAAGCCCGACGCTCTGTTGGTCGAGCTCGTGGCCGAGCGCTTCGACCTTGCCTTTTACACGAGGCTGTACGAC
ATGTCTGCCGAGGTGTCTCTCGGGGCTGTATCTGTGGACGACTTCGTCGACAATCCCCCTGCAGAGTTCAAGTCC
ATCGTCTCGTCCGGTGACAGTGATGACCTCCAGGAAGGCCGGAGTCTGGTCCACGTCAAGTACATGGATGTCAAG
CCACAGTCGCCCGAGTTTATGCCCGTTTACGAGGGAGTCAAGACGAACATCAGTGCCTCGGTGTTAACCATCAAC
CTCGTCGTGACGAGGAAGACGCTACTGACGCTCCTCGACTTCATTCTCGTCACCTTTGCCGGAGGCAACAACGAC
CAGGAACAAAGCCGAACGGCCGTCACCGATGGTCAAGGCGCCGGACACGAAGAGACGGCTACGGAGCCGGCCAAG
CAAAACGCCGACTCGGGTTCCATCAGAGTCAAGGTGGATCTGAAGGGCATCAGGCTCATCCTCAACAACGACGGC
ATAAGGTTGGCGACGCTGTCGCTCACGGAGGCCGACGCCGGCATATTCCTGCGCGGAAACACGATGCGAATATTT
GCAAAGCTCGGAGATTTGTCTCTCGTCGACGACGTCAACCTGGGCGTCTCCAGGGACTCCAACCTGCGGAGACTC
GTCACCATTCAAGGCGACGAACTCGCCGATTTCCGCTACGAGACGTTTGACGCCGACAACAAGCAGGCGTATCCG
GGCCATGACAGCGCCATCTTCCTGCGGGCCGGTTCGGTCAAGGTAAACTTCGTCGAGGAGCCGTTCCGCAAGATC
ATCGACTTCCTCGTCAAGTTCGGCAGGATGCAAGCCCTTTACAACGCTGCACGACAGGCCGCCGTGACACGGGCC
AACCAGATGCAGCAGAGTCCCAGCAGGTTCAAGTTTGACGTCGTCATCAAGACGCCCATCGTCGTCTTCCCGCGC
TTGATGGTCTCGGAGTCTCCTGAACGCGACGTCGTGACGGCATACCTGGGCGAGATCTATGCGCAGAACGAGTTT
GCGCCTCTCGATGATGGCGAGGCTTCTCGGATCGCCATGAAGATATCCACGGGCATCAGGAAGATCCGGCTTACG
TCCGACTTCAACTACGACAACGACAGATCGGAAGAGCTAGAGATGATAGATCAGGTTGACCTTGGGCTGAGCATC
ACCTATGCCGAGCACAAGCATGGCGTCATGCGCCCAGACACGGAGATCGAGGCGTCCATGTCGGACATCAAGCTC
AGGCTCACGCAGCATCAGCTCAAGTTCCTGCTGGAGATCTCCAAAGCAGTTCCTGCTGCCTTTGCTGGCGACGGC
AGCACCGGCGACGAGGACGCGGCTCAGCTCGTCGACGAGGAGACGCTGCGGCGCGCCAGAACGGCGTCGGCAGAC
CATGGTATCGGCCCTGACCAGCACGCCGTCGACCTCGGGCCCGAGTTGAAGTCGCCTACGGATACGTGGACCCAG
CTCGACTTGGTGTTCCGAGTCGACACCATCGGTCTCGAACTCATCATGGCACCGCTGGACGAGCCCGTGGGCGAC
TTGGCCGCGTCCAGCCTGTCTCGCTTCTCGCTCGACGAAACCAAGGTGAAGACGCGGATGATGTCGGATGGCTCG
CTGGAAGCCGAGTTGCTCATTCGCTCCTTGACCATCTACGACAGCCGTCCGAAAGGAGTCAACAAGTTCCGTCGC
ATCATGAGCTCTTCAAACAAAGAGTCCCAGCAACTCATGGCGAGCGTCACCATGTCGGGCGGCAAGGAGAGCAGC
ATGATCGCCATGGCGACCATCGACAGCCCTCGCGTCATCTTCGCGCTCGACTACCTCTTCGCTCTCCAGGCGTTT
GCCACCGAAGGCCTCAAGGTGGAAGATTCCAGCCCGCTGGACGATGTCAGCACCGACGAGTCACCAGAAGGCTCG
GAAGATGCCGACTCGTTGCGAGTGTCGTCCACTAAGCCTGGTCCGTCTCAGGCGACGTCTCCGCGACGCAGCGAA
TCCAGCTCCGGCGAGCCGCAGAAGCGTCAAGGCGAGGCTTCGATGAGCTTGGCCTTGCGAGTCAACCTCGTCGAC
GCGCAGGTCATACTCATCGCCAACCCGCTGAGGTCCAATTCCGAAGCCATCGTCCTGGGCATCCGACAGGTGCTT
CTATCGCAACAGAACGCACTCACGTTCCAGGTCTCCGAGATGGGCATGTTTCTATGCGTCATGGACAGGTTCGAG
ACGTCGCGCCTCAGAATCATCGACGACTTTTCGATACAGTTGAACATGGACAACTCGCAGCCATTCACGGCCAGC
TATCACGTCGATGTCGAGCCTCTCATCGTTCGACTCTCCCTGAGAGATATTCTCCTCGTGCTCCAGATCGTCGCC
AAAGCCAGCGAGCTCTCGGAAAGCGGGAAAGAGCCGGTCAAAGAGACGCCGGCGGAGCAAAAGGCGAAGCAGCTC
AGAGGCGCCAGCTGCAAGTCAAAGGCCCCCAGCGGCCGCGCCCTGTCGACGGCGGCTCAGACCAAGGCCAACCAG
GCCGTTGTCACCAAAGGAGCCGCGGCGACAAAGCCACGCGGCAGAAGCACGCATGAGGAGCTCTCTGCGACGCTT
CAGGGCATGCGGATCGTGCTGATCGGAGACCTGCACGAGCTGCCCATCGTCGACGTCGGAGTCAAGGAGTTTACG
GCCACGGCAGAGAACTGGTCGTCGAATCTGAAAGCCGAGGCGGCCATACACACGTACACGAACGTCTACAACTTT
TCGAAATCCAGCTGGGAGCCCCTGATCGAACCATGGCAGGTCGGCCTGGGCGTGGCCAGAGACTCGACCACGGGC
GTACTGTCGGTCGACGTGGCCTCGGCCAAGACGCTGGATATCACGATCACGACGGCGACCATCGCAGTGGCTTCC
AAGTCGCTCGACTTTCTCACGACGCAGGAAGACGTCTTGGACAAACCAAGGTGGAGCGACGCGCCTTACCGCATC
AGAAACCACACTGGATTCGTCATCACGATGCACTCGCGAAGCCCAAGCAGCGAAGAGTCCATCGACCTGCGGCTC
GACGACGGAGAGGAGGCACCGTGGACCTTTGAAGAATGGGAGAAGATGCGCGAGAACATCCTGACCAAAGGCGCC
GCCCAGAATGACGTGGGCATCAAGTTGGAGGGCAGCGGCTTCGACACCGTGAAGAACGTGCGGGTGAACCGAGAG
GGCGAGTATCTCTACAGCCTGCGGCCCAAGACGGACAACGTGACGCATCGGCTGTGCGTCGACGTACGTCTCGGG
TCTGACAATGTCAAGGACGTGACGCTACGATCTCCGCTGCTCGTCGAGAACGCGACGGAGATCCCGGTCGAGCTC
GGCATCTACGACGCTTCAGAGGGTCACCTTCTCAAGATCGAGAAGATCGCTCCCGGGGACTCGCGTCCGGCCCCG
GTCGGCGCCGCGTACGAAAAGAAGATGATTGTGCGTCCGGACAGCGGCTTCGGCTATCAGTGGAGCAGAGACCAG
CTCTGGTGGAGGGATCTGCTCAAGCGACCGACCAAGCAGCTCGTCTGCACGGGGGATACCGGCGATTCGTTCTAC
TTTCAGGTCCACGCGGACTTTGACAAGACCAACCCATTGACCAAGTGAGTATCTTTGTTCTCCCGGCCGGTTCTG
CGTTAATGGAGGAATCAAAAAAGGGCATATCCGTCGATGAAGATCAAGCTCTCGGCTCCGGTGACGCTGGAAAAC
CTGTTGCCGTACGACTTCAAGTACAGGATCTACGACAGGAACACCAAGAAGGACTGGTCCAACTTTCTGAGAAAG
GGCGGCGTGAGCCCCGTCCACATGGTGGAGCTCTCTCATCTCCTACTCCTGAGCGTCGATATGCAGGACACCATC
TTCAAGCCGAGCGACTTCTCCATCATCAACTCCGGAAGCAACGACGACTTCCGCAAGGAGAAGCGGCTCCTGGTC
AGGGACGAGCAAGGCCTGACGCTGCACCTCAGCCTCCACTACTTCAAAGTGCCCAAGAGCGGCGGCGCGTTCAAG
ATCAGCGTGTACAGCCCCTACGTCGTGTTGAACAAGACGGGTCTCGACATGGGGATCCGCGCCAAGAGCTTCCTA
CAGCAGGCCAAGGCGGCGGCCGGTCAGTTCCCCGTGGCGCAGACGGGAAGCCAAGATAGGCCGAAGGCGCTGCCG
TTCATGTTCTCGTTCGGAAACGACGAGCATCAGAACCGGGCGCTGCTCAAGGTGGACGAGTCGGAGTGGAGCAAG
CCGCAGAGCTTCGACGCCGTGGGGAGCACGTCGGAAGTGGTGCTGAACTCGTCGACGTCGAAGCATAGGGAGATT
CACCTGGGCATCACGGTCAAGTCGGGAGACGGCAAGTACAAGATGACGCGGGTCGTGACGCTGGCGCCGCGCTTC
GTGCTGGTCAACAAGCTGGGCGAGGAGGTTCTGGTGCGAGAGTCGGGCTCGTCGAACCACATGACCATCAGATCC
GGAGTTCTGCATCCGCTGCATTTCATGCAGAAGTCGGCGGTCAAGCAGCTGTGCCTGCGCTTCCCGGGCGTCGAC
AACCACTGGACGTCGCCCTTCAACATCGCCGATCTCGGGACTACGCACGTCAAGATGGCCAGGGCCGGACAGCGG
CAGCGGCTGGTGCGGGTCGAGATACTCACGGAGGAGTCGACCATCTTCTTGCACATGAGCGTCGAGGGAAAGCAC
TGGCCCTTTTCCATGCGTAACGAGAGCGACACCGAGTTCTCCTTTTACCAGGCCAACCCCAACGTCGACGAGGAC
GACGACGAGGACCGAAGCGGGTGGAAGCCGGTGCGGTACCGGCTGCCGCCTCGGAGCGTGATGCCGTACGCCTGG
GACTTTCCGGCTGCCAAGTTCCGCGAGGTGGTGATTTCTACATGCGGCAAGGAGCGTCACGTCAAGCTGGCCGAG
ATGGGCAATCAGATCCCGATGAAGTTTGCCGGACCCGGCGGGCAGCAGAAGATCATCGACATCAACGTGGCTGCC
GACGGGCCGATGCAGACGCTGATCCTCAGCAACTTCCGGGCCAGCAGGAGCATGTTCAAGCCGGCAGCGGTGTCG
AGGACCAACACGGGGCCCGAGGCGTTCGAGGTCAAGGACCAGGGCACCGGGGCCACCATGTTGGCGCAGCTCAAG
CTGTCGGGCATCGGCGTCTCGCTCATCAACGCGCACCTCAAGGAGCTGGCGTACGTGACGCTTCGCGAGGTGCAG
CTACGGCTCAGCGACTCGCCGCTGATACAGACCATGTCGCTGGCGGTCAAGTGGATTCAGATAGACAACCAGCTC
TACGGCGGCATCTTCCCCATCGTGCTATACCCGAGCGTTGTGCCCAAGCGGGCCAACGAGGTCGAGGCGCACCCG
TCGCTGCACGCCATGGTCAGCCGGGTCAAGGACGACTCGTACGGGGTGCTGTACATCAAGTACGCGACGGTGCTG
CTGCAGCAGATGACGGTGGACCTGGACGAGGACTTCGTCTTTGCCCTGCTCGACTTCTCCAACGTTCCGGGCGCC
AGCTGGACGGCGGTCGAAGGGCCCGGGTCCGGCCGGCTCTGCGACGAGGACCTCGACATCCCCGAGCCGTCGCAG
CAGCAGTCCGGGCAGGACATGTACTTTGAGGTGCTCAACATCCAGCCGATGCAGATCGACCTGAGCTTCGTGCGG
ACGGAGCGGGTCAACGCCGAGGATAAGACGTCGACGCGGAACCCAATCATGTTCTTCCTCAACGTCATGACCATG
GCCATTGGCAACGTCAACGACGCGCCCGTCCGCTTCAACGCCCTGATGCTGGACAATGTGAGGGTGTCGCGGGCG
GTGCTGGTGCAGAACGTGTCGAGCCACTACAGCCAAGAGGTCATGTATCAGATCCACAAGATACTGGGCTCGGCC
GACTTCCTGGGTAACCCTGTCGGGCTGTTCAACAACATCTCGTCGGGCGTGACGGACATCTTCTACGAGCCGTAC
CAGGGGCTCATCCTTTCGGACCGGCCCGAGGAGTTTGGCATCGGCATCGCGCGCGGAGCCGTCTCGTTCGCCAAG
AAGACGGTATACGGCTTCAGCGACAGCTTCTCCAAGTTTACGGGCAGCCTGGGCAAGGGCCTGGCGGCGGCATCG
CTGGACAAGCAGTTCCAGGACCGGCGGCGGATCACGAGGGCTCGCAACCGGCCCAAGCACGCGCTGTACGGGGTG
GCGGCCGGTGCCAACTCGCTGCTGACGAGCGTGGCGTCGGGGGTCGGGGGTTTGGCGCGCAAGCCGCTCGAGGGC
GCCGAGCAAGAGGGCGCCCTGGGCTTCTTCAAGGGCGTGGGCAAGGGCGTGCTCGGGCTGGCGACGAAGCCGGCG
GTAGGGGTGCTGGACATGGCCAGCAACGTCAGCGAGGGCATCCGCAACACGACGACGGTCTTTGACGGATCGGAG
CTGGAGAGAACGCGGCTTCCGCGCTTCATGGCCAACGACGGCATCGTGCGGCCGTACGGGGCGCGAGAGGCGCTG
GGTCAGTTCTGGCTGAAGCAGGTCGACAACGGCAAGTACTTTGACGAGCAGTACGTCGGCCACCTGGAGCTGCCT
CGCGAGGACATGGTGGTCATGGTGACGTACGCGCGCATCCTGCTGATCCGGTCTCGGCGCCTGACGAGCGAGTGG
GACGTCAAGCTCAAAGACGTGCAGACGGTGGCCAAGGAGAGGACGGGCGTGAGCCTGACGCTGCGGGGGGGCACC
AACGGGCCGTTCATCCCGGTGGGCGGCGGCAGCGAGCGGGGATATCTGTACCGGATGATTGGCGTGGCGGCCGAG
GAATTCAATCGGCGTTTCCGGGGCGCCGAGTGA

© 2023 - Robin Ohm - Utrecht University - The Netherlands

Built with Python Django and Wagtail