Fungal Genomics

at Utrecht University

General Properties

Protein IDOphcf2|00643
Gene name
Locationscaffold_01:2486283..2488233
Strand-
Gene length (bp)1950
Transcript length (bp)1797
Coding sequence length (bp)1797
Protein length (aa) 599

Overview

Your browser does not support drawing a protein figure.

PFAM Domains

PFAM Domain ID Short name Long name E-value Start End
PF07662 Nucleos_tra2_C Na+ dependent nucleoside transporter C-terminus 8.8E-71 369 581
PF01773 Nucleos_tra2_N Na+ dependent nucleoside transporter N-terminus 2.7E-22 184 254

GO

(None)

Deeploc

[Help with interpreting the results of Deeploc 2.0]
Localizations Signals Cytoplasm Nucleus Extracellular Cell membrane Mitochondrion Plastid Endoplasmic reticulum Lysosome vacuole Golgi apparatus Peroxisome
Endoplasmic reticulum Transmembrane domain 0.0962 0.2096 0.0819 0.3052 0.1482 0.0159 0.4321 0.3976 0.2168 0.0111

SignalP

(None)

Transmembrane Domains

Domain # Start End Length
1 73 95 22
2 105 127 22
3 148 167 19
4 177 196 19
5 203 225 22
6 263 285 22
7 298 320 22
8 340 362 22
9 431 453 22
10 463 482 19
11 525 547 22
12 562 584 22

Transcription Factor Class

(None)

CAZymes

(None)

Secondary Metabolism

(None)

Expression data

Analysis 1: Expression analysis during behavioral modification. Published in: Will et al., G3, 2020

Expression values

Label Description Expression (RPKM) Confidence interval (low) Confidence interval (high)
Fungus Fungus in pure culture 23.72 12.54 34.91
Alive In ants, during behavior modification 361.97 116.22 607.72
Dead In ants, recently dead 145.29 73.78 216.81

Differential expression

Label1 Label2 Q-value Significant difference
Alive Fungus 0.000238 yes
Alive Dead 0.000238 yes
Dead Fungus 0.000238 yes

Orthologs

Orthofinder run ID4
Orthogroup2096
Change Orthofinder run
Species Protein ID
Ophiocordyceps australis 1348a (Ghana) OphauG2|3931
Ophiocordyceps australis map64 (Brazil) OphauB2|7983
Ophiocordyceps camponoti-floridani Ophcf2|00643 (this protein)
Ophiocordyceps camponoti-rufipedis Ophun1|2028
Ophiocordyceps kimflemingae Ophio5|821
Ophiocordyceps subramaniannii Hirsu2|2464

Sequences

Type of sequenceSequence
Locus Download genbank file of locus Download genbank file of locus (reverse complement)
The gene with 5 kb flanks (if sufficient flanking sequence is available). For use in cloning design programs. NOTE: features (genes or exons) that are only partially contained within the sequence are completely excluded.
Protein >Ophcf2|00643
MVAAHLDSARDGPARTSDADYKAEKTDVPTADFGDAEKGEAGQGSTELTSAPGDDAVAGRSRFGRLDSSRHRRIL
VHIVIFLVFTGWWIASLILHRHDKNWIVPFLLWLAITLRLVFYYVPIRYVSGPIRWLWRHSALVVYDAVPSRFRT
LVGGLAAVAVVLVGSFVTEESADNTRANRAVSLFGMAVILLAFYLTSAARRRINWRTVIVGMLTQYIIGLFVLRT
SVGYDIFKFIAERAGDLLGFAKDGVGFLTTPDVARLPWFLLGVVPAIIFFISLVQVLYHIGFLQWFIRKFATFVF
WAMGVSGAEAVVAAATPFIGQGESAMLVRPFVPHMTRAEIHQILTCGFATISGSVLVGYIGLGLNPEALVSSCIM
SIPASLAISKLRYPETEETLTAGRVVLPDDEDNKAENGLHAFANGAWLGIKIGGTIIASLLCILAAVGLVNGLLS
WWGRYLDINDPQLTLQTILSYVFYPVAFLLGVPRNGDLLKVAKLIAEKVVTNEYNAFTKLAHDPEYANLSARSQL
IATYAVCGFGNIGSLGIQIGILGQLAPSRGGDVSRLALSALVSGVMSTLTSATVAGLVVTTQISNFTRGGASS*
Coding >Ophcf2|00643
ATGGTCGCTGCTCACCTCGACTCGGCCCGCGACGGCCCCGCCCGGACCTCCGACGCCGACTACAAGGCCGAGAAG
ACGGACGTGCCGACGGCGGACTTTGGGGATGCCGAGAAGGGAGAGGCTGGTCAGGGTTCGACGGAGCTGACTTCG
GCGCCTGGTGATGATGCCGTCGCTGGCAGGTCTCGCTTCGGACGTCTCGATAGTAGCCGCCATCGTCGCATCTTG
GTTCACATCGTCATCTTCCTCGTCTTTACCGGCTGGTGGATCGCCTCGCTCATCCTTCACCGCCATGACAAGAAT
TGGATCGTGCCGTTTCTGCTATGGCTGGCCATCACCCTCCGCCTCGTCTTCTACTACGTTCCCATCCGGTACGTG
TCCGGGCCGATCCGCTGGCTATGGCGCCACTCAGCGCTCGTCGTGTACGATGCCGTACCGTCTCGCTTCCGGACT
CTGGTCGGCGGCCTCGCTGCCGTTGCCGTCGTCCTCGTCGGCTCCTTCGTTACGGAGGAGAGCGCGGATAACACG
CGAGCTAACCGGGCTGTAAGCCTCTTTGGCATGGCCGTCATCCTCTTGGCTTTTTACCTGACGAGCGCGGCTCGA
CGGCGCATCAACTGGCGGACCGTCATCGTCGGCATGCTGACGCAGTACATCATCGGTCTCTTCGTCCTGCGTACC
TCGGTGGGCTATGACATCTTCAAGTTCATCGCCGAGAGGGCCGGCGATCTGCTCGGCTTCGCAAAGGACGGTGTT
GGCTTCCTGACGACTCCCGACGTGGCCCGTCTCCCATGGTTCCTACTCGGCGTCGTCCCGGCCATCATCTTCTTC
ATCTCGCTCGTGCAGGTGCTCTATCACATCGGCTTCCTACAGTGGTTCATCCGCAAGTTCGCAACCTTTGTCTTC
TGGGCCATGGGCGTCTCCGGCGCAGAGGCCGTCGTCGCCGCTGCGACGCCCTTTATCGGCCAGGGCGAGTCGGCC
ATGCTGGTCCGCCCCTTTGTGCCGCACATGACGCGCGCGGAGATTCACCAGATCCTCACCTGCGGCTTCGCCACC
ATCTCGGGCTCCGTCCTCGTCGGCTACATCGGCCTGGGCCTCAACCCGGAAGCCCTCGTCTCGTCATGCATCATG
TCCATCCCCGCCTCACTCGCCATCTCCAAGCTGCGCTACCCGGAGACGGAGGAGACGCTGACGGCCGGTCGGGTC
GTGCTGCCCGACGACGAGGACAACAAGGCCGAGAACGGGCTTCATGCCTTTGCCAACGGCGCCTGGCTGGGCATC
AAGATTGGCGGCACAATCATTGCCTCTCTGCTGTGCATCCTGGCTGCTGTCGGGCTCGTCAACGGCCTGCTGTCG
TGGTGGGGGCGATATCTCGACATCAACGACCCGCAGTTGACGCTACAGACCATCTTATCCTACGTGTTTTACCCC
GTCGCCTTTCTCCTCGGCGTCCCGCGCAACGGCGACCTCCTCAAGGTGGCCAAGCTGATAGCCGAAAAGGTAGTG
ACGAACGAATACAACGCCTTCACCAAACTCGCCCACGACCCCGAATACGCCAACCTCTCAGCCCGCTCCCAGCTC
ATCGCCACCTACGCCGTCTGCGGCTTCGGCAACATCGGCTCCCTCGGCATCCAGATCGGCATCCTCGGCCAGCTC
GCCCCCTCGCGCGGAGGAGACGTCTCGAGGCTCGCCCTCTCGGCCCTCGTCTCGGGCGTCATGTCGACGCTCACC
TCGGCCACCGTCGCCGGCCTCGTCGTCACCACTCAGATCTCCAACTTTACTCGCGGGGGGGCTTCTTCGTGA
Transcript >Ophcf2|00643
ATGGTCGCTGCTCACCTCGACTCGGCCCGCGACGGCCCCGCCCGGACCTCCGACGCCGACTACAAGGCCGAGAAG
ACGGACGTGCCGACGGCGGACTTTGGGGATGCCGAGAAGGGAGAGGCTGGTCAGGGTTCGACGGAGCTGACTTCG
GCGCCTGGTGATGATGCCGTCGCTGGCAGGTCTCGCTTCGGACGTCTCGATAGTAGCCGCCATCGTCGCATCTTG
GTTCACATCGTCATCTTCCTCGTCTTTACCGGCTGGTGGATCGCCTCGCTCATCCTTCACCGCCATGACAAGAAT
TGGATCGTGCCGTTTCTGCTATGGCTGGCCATCACCCTCCGCCTCGTCTTCTACTACGTTCCCATCCGGTACGTG
TCCGGGCCGATCCGCTGGCTATGGCGCCACTCAGCGCTCGTCGTGTACGATGCCGTACCGTCTCGCTTCCGGACT
CTGGTCGGCGGCCTCGCTGCCGTTGCCGTCGTCCTCGTCGGCTCCTTCGTTACGGAGGAGAGCGCGGATAACACG
CGAGCTAACCGGGCTGTAAGCCTCTTTGGCATGGCCGTCATCCTCTTGGCTTTTTACCTGACGAGCGCGGCTCGA
CGGCGCATCAACTGGCGGACCGTCATCGTCGGCATGCTGACGCAGTACATCATCGGTCTCTTCGTCCTGCGTACC
TCGGTGGGCTATGACATCTTCAAGTTCATCGCCGAGAGGGCCGGCGATCTGCTCGGCTTCGCAAAGGACGGTGTT
GGCTTCCTGACGACTCCCGACGTGGCCCGTCTCCCATGGTTCCTACTCGGCGTCGTCCCGGCCATCATCTTCTTC
ATCTCGCTCGTGCAGGTGCTCTATCACATCGGCTTCCTACAGTGGTTCATCCGCAAGTTCGCAACCTTTGTCTTC
TGGGCCATGGGCGTCTCCGGCGCAGAGGCCGTCGTCGCCGCTGCGACGCCCTTTATCGGCCAGGGCGAGTCGGCC
ATGCTGGTCCGCCCCTTTGTGCCGCACATGACGCGCGCGGAGATTCACCAGATCCTCACCTGCGGCTTCGCCACC
ATCTCGGGCTCCGTCCTCGTCGGCTACATCGGCCTGGGCCTCAACCCGGAAGCCCTCGTCTCGTCATGCATCATG
TCCATCCCCGCCTCACTCGCCATCTCCAAGCTGCGCTACCCGGAGACGGAGGAGACGCTGACGGCCGGTCGGGTC
GTGCTGCCCGACGACGAGGACAACAAGGCCGAGAACGGGCTTCATGCCTTTGCCAACGGCGCCTGGCTGGGCATC
AAGATTGGCGGCACAATCATTGCCTCTCTGCTGTGCATCCTGGCTGCTGTCGGGCTCGTCAACGGCCTGCTGTCG
TGGTGGGGGCGATATCTCGACATCAACGACCCGCAGTTGACGCTACAGACCATCTTATCCTACGTGTTTTACCCC
GTCGCCTTTCTCCTCGGCGTCCCGCGCAACGGCGACCTCCTCAAGGTGGCCAAGCTGATAGCCGAAAAGGTAGTG
ACGAACGAATACAACGCCTTCACCAAACTCGCCCACGACCCCGAATACGCCAACCTCTCAGCCCGCTCCCAGCTC
ATCGCCACCTACGCCGTCTGCGGCTTCGGCAACATCGGCTCCCTCGGCATCCAGATCGGCATCCTCGGCCAGCTC
GCCCCCTCGCGCGGAGGAGACGTCTCGAGGCTCGCCCTCTCGGCCCTCGTCTCGGGCGTCATGTCGACGCTCACC
TCGGCCACCGTCGCCGGCCTCGTCGTCACCACTCAGATCTCCAACTTTACTCGCGGGGGGGCTTCTTCGTGA
Gene >Ophcf2|00643
ATGGTCGCTGCTCACCTCGACTCGGCCCGCGACGGCCCCGCCCGGACCTCCGACGCCGACTACAAGGCCGAGAAG
ACGGACGTGCCGACGGCGGACTTTGGGGATGCCGAGAAGGGAGAGGCTGGTCAGGGTTCGACGGAGCTGACTTCG
GCGCCTGGTGATGATGCCGTCGCTGGCAGGTCTCGCTTCGGACGTCTCGATAGTAGCCGCCATCGTCGCATCTTG
GTTCACATCGTCATCTTCCTCGTCTTTACCGGCTGGTGGATCGCCTCGCTCATCCTTCACCGCCATGACAAGAAT
TGGATCGTGCCGTTTCTGCTATGGCTGGCCATCACCCTCCGCCTCGTCTTCTACTACGTTCCCATCCGGTACGTG
TCCGGGCCGATCCGCTGGCTATGGCGCCACTCAGCGCTCGTCGTGTACGATGCCGTACCGTCTCGCTTCCGGACT
CTGGTCGGCGGCCTCGCTGCCGTTGCCGTCGTCCTCGTCGGCTCCTTCGTTACGGAGGAGAGCGCGGATAACACG
CGAGCTAACCGGGCTGTAAGCCTCTTTGGCATGGCCGTCATCCTCTTGGCTTTTTACCTGACGAGCGCGGCTCGA
CGGCGCATCAACTGGCGGACCGTCATCGTCGGCATGCTGACGCAGTACATCATCGGTCTCTTCGTCCTGCGTACC
TCGGTGGGCTATGACATCTTCAAGTTCATCGCCGAGAGGGCCGGCGATCTGCTCGGCTTCGCAAAGGACGGTGTT
GGCTTCCTGACGACTCCCGACGTGGCCCGTCTCCCATGGTTCCTACTCGGCGTCGTCCCGGCCATCATCTTCTTC
ATCTCGCTCGTGCAGGTGCTCTATCACATCGGCTTCCTACAGTGGTTCATCCGCAAGTTCGCAACCTTTGTCTTC
TGGGCCATGGGCGTCTCCGGCGCAGAGGCCGTCGTCGCCGCTGCGACGCCCTTTATCGGCCAGGGCGAGTCGGCC
ATGCTGGTCCGCCCCTTTGTGCCGCACATGACGCGCGCGGAGATTCACCAGATCCTCACCTGCGGCTTCGCCACC
ATCTCGGGCTCCGTCCTCGTCGGCTACATCGGCCTGGGCCTCAACCCGGAAGCCCTCGTCTCGTCATGCATCATG
TCCATCCCCGCCTCACTCGCCATCTCCAAGCTGCGCTACCCGGAGACGGAGGAGACGCTGACGGCCGGTCGGGTC
GTGCTGCCCGACGACGAGGACAACAAGGCCGAGAACGGGCTTCATGCCTTTGCCAACGGCGCCTGGCTGGGCATC
AAGATTGGCGGCACAATCATTGCCTCTCTGCTGTGCATCCTGGCTGCTGTCGGGCTCGTCAACGGCCTGCTGTCG
TGGTGGGGGCGATATCTCGACATCAACGACCCGCAGTTGACGCTACAGACCATCTTATCCTACGTGTTTTACCCC
GTCGCCTTTCTCCTCGGCGTCCCGCGCAACGGCGACCTCCTCAAGGTGGCCAAGCTGATAGCCGAAAAGGTAGTG
ACGGTAAGCCTCATCTTCCTCCTCTTCCTCTTCTTTCTCCTCCTCTTCCTTCTCCTCTTCCTTCTCTTCTTCCTC
CTCCTCCTCCTCCTCCTCCATCCCCCCCCCCCACCCCCCTCATCTCCATCATCTACACTCGCTCACAAAACAAAC
GCCCAGAACGAATACAACGCCTTCACCAAACTCGCCCACGACCCCGAATACGCCAACCTCTCAGCCCGCTCCCAG
CTCATCGCCACCTACGCCGTCTGCGGCTTCGGCAACATCGGCTCCCTCGGCATCCAGATCGGCATCCTCGGCCAG
CTCGCCCCCTCGCGCGGAGGAGACGTCTCGAGGCTCGCCCTCTCGGCCCTCGTCTCGGGCGTCATGTCGACGCTC
ACCTCGGCCACCGTCGCCGGCCTCGTCGTCACCACTCAGATCTCCAACTTTACTCGCGGGGGGGCTTCTTCGTGA

© 2023 - Robin Ohm - Utrecht University - The Netherlands

Built with Python Django and Wagtail