Fungal Genomics

at Utrecht University

General Properties

Protein IDOphcf2|00643
Gene name
Locationscaffold_01:2486283..2488233
Strand-
Gene length (bp)1950
Transcript length (bp)1797
Coding sequence length (bp)1797
Protein length (aa) 599

Your browser does not support drawing a protein figure.

PFAM Domains

PFAM Domain ID Short name Long name E-value Start End
PF07662 Nucleos_tra2_C Na+ dependent nucleoside transporter C-terminus 8.8E-71 369 581
PF01773 Nucleos_tra2_N Na+ dependent nucleoside transporter N-terminus 2.7E-22 184 254

GO

(None)

SignalP

[Help with interpreting these statistics]
SignalP signal predicted Location
(based on Ymax)
D score
(significance: > 0.45)
No 1 - 66 0.45

Transmembrane Domains

Domain # Start End Length
1 73 95 22
2 105 127 22
3 148 167 19
4 177 196 19
5 203 225 22
6 263 285 22
7 298 320 22
8 340 362 22
9 431 453 22
10 463 482 19
11 525 547 22
12 562 584 22

Transcription Factor Class

(None)

Expression data

Analysis 1: Expression analysis during behavioral modification. Published in: Will et al., G3, 2020

Click here for more information

Sequences

Type of sequenceSequence
Locus Download genbank file of locus
The gene with 5 kb flanks (if sufficient flanking sequence is available). For use in cloning design programs. NOTE: features (genes or exons) that are only partially contained within the sequence are completely excluded.
Protein >Ophcf2|00643
MVAAHLDSARDGPARTSDADYKAEKTDVPTADFGDAEKGEAGQGSTELTSAPGDDAVAGRSRFGRLDSSRHRRIL
VHIVIFLVFTGWWIASLILHRHDKNWIVPFLLWLAITLRLVFYYVPIRYVSGPIRWLWRHSALVVYDAVPSRFRT
LVGGLAAVAVVLVGSFVTEESADNTRANRAVSLFGMAVILLAFYLTSAARRRINWRTVIVGMLTQYIIGLFVLRT
SVGYDIFKFIAERAGDLLGFAKDGVGFLTTPDVARLPWFLLGVVPAIIFFISLVQVLYHIGFLQWFIRKFATFVF
WAMGVSGAEAVVAAATPFIGQGESAMLVRPFVPHMTRAEIHQILTCGFATISGSVLVGYIGLGLNPEALVSSCIM
SIPASLAISKLRYPETEETLTAGRVVLPDDEDNKAENGLHAFANGAWLGIKIGGTIIASLLCILAAVGLVNGLLS
WWGRYLDINDPQLTLQTILSYVFYPVAFLLGVPRNGDLLKVAKLIAEKVVTNEYNAFTKLAHDPEYANLSARSQL
IATYAVCGFGNIGSLGIQIGILGQLAPSRGGDVSRLALSALVSGVMSTLTSATVAGLVVTTQISNFTRGGASS*
Coding >Ophcf2|00643
ATGGTCGCTGCTCACCTCGACTCGGCCCGCGACGGCCCCGCCCGGACCTCCGACGCCGACTACAAGGCCGAGAAG
ACGGACGTGCCGACGGCGGACTTTGGGGATGCCGAGAAGGGAGAGGCTGGTCAGGGTTCGACGGAGCTGACTTCG
GCGCCTGGTGATGATGCCGTCGCTGGCAGGTCTCGCTTCGGACGTCTCGATAGTAGCCGCCATCGTCGCATCTTG
GTTCACATCGTCATCTTCCTCGTCTTTACCGGCTGGTGGATCGCCTCGCTCATCCTTCACCGCCATGACAAGAAT
TGGATCGTGCCGTTTCTGCTATGGCTGGCCATCACCCTCCGCCTCGTCTTCTACTACGTTCCCATCCGGTACGTG
TCCGGGCCGATCCGCTGGCTATGGCGCCACTCAGCGCTCGTCGTGTACGATGCCGTACCGTCTCGCTTCCGGACT
CTGGTCGGCGGCCTCGCTGCCGTTGCCGTCGTCCTCGTCGGCTCCTTCGTTACGGAGGAGAGCGCGGATAACACG
CGAGCTAACCGGGCTGTAAGCCTCTTTGGCATGGCCGTCATCCTCTTGGCTTTTTACCTGACGAGCGCGGCTCGA
CGGCGCATCAACTGGCGGACCGTCATCGTCGGCATGCTGACGCAGTACATCATCGGTCTCTTCGTCCTGCGTACC
TCGGTGGGCTATGACATCTTCAAGTTCATCGCCGAGAGGGCCGGCGATCTGCTCGGCTTCGCAAAGGACGGTGTT
GGCTTCCTGACGACTCCCGACGTGGCCCGTCTCCCATGGTTCCTACTCGGCGTCGTCCCGGCCATCATCTTCTTC
ATCTCGCTCGTGCAGGTGCTCTATCACATCGGCTTCCTACAGTGGTTCATCCGCAAGTTCGCAACCTTTGTCTTC
TGGGCCATGGGCGTCTCCGGCGCAGAGGCCGTCGTCGCCGCTGCGACGCCCTTTATCGGCCAGGGCGAGTCGGCC
ATGCTGGTCCGCCCCTTTGTGCCGCACATGACGCGCGCGGAGATTCACCAGATCCTCACCTGCGGCTTCGCCACC
ATCTCGGGCTCCGTCCTCGTCGGCTACATCGGCCTGGGCCTCAACCCGGAAGCCCTCGTCTCGTCATGCATCATG
TCCATCCCCGCCTCACTCGCCATCTCCAAGCTGCGCTACCCGGAGACGGAGGAGACGCTGACGGCCGGTCGGGTC
GTGCTGCCCGACGACGAGGACAACAAGGCCGAGAACGGGCTTCATGCCTTTGCCAACGGCGCCTGGCTGGGCATC
AAGATTGGCGGCACAATCATTGCCTCTCTGCTGTGCATCCTGGCTGCTGTCGGGCTCGTCAACGGCCTGCTGTCG
TGGTGGGGGCGATATCTCGACATCAACGACCCGCAGTTGACGCTACAGACCATCTTATCCTACGTGTTTTACCCC
GTCGCCTTTCTCCTCGGCGTCCCGCGCAACGGCGACCTCCTCAAGGTGGCCAAGCTGATAGCCGAAAAGGTAGTG
ACGAACGAATACAACGCCTTCACCAAACTCGCCCACGACCCCGAATACGCCAACCTCTCAGCCCGCTCCCAGCTC
ATCGCCACCTACGCCGTCTGCGGCTTCGGCAACATCGGCTCCCTCGGCATCCAGATCGGCATCCTCGGCCAGCTC
GCCCCCTCGCGCGGAGGAGACGTCTCGAGGCTCGCCCTCTCGGCCCTCGTCTCGGGCGTCATGTCGACGCTCACC
TCGGCCACCGTCGCCGGCCTCGTCGTCACCACTCAGATCTCCAACTTTACTCGCGGGGGGGCTTCTTCGTGA
Transcript >Ophcf2|00643
ATGGTCGCTGCTCACCTCGACTCGGCCCGCGACGGCCCCGCCCGGACCTCCGACGCCGACTACAAGGCCGAGAAG
ACGGACGTGCCGACGGCGGACTTTGGGGATGCCGAGAAGGGAGAGGCTGGTCAGGGTTCGACGGAGCTGACTTCG
GCGCCTGGTGATGATGCCGTCGCTGGCAGGTCTCGCTTCGGACGTCTCGATAGTAGCCGCCATCGTCGCATCTTG
GTTCACATCGTCATCTTCCTCGTCTTTACCGGCTGGTGGATCGCCTCGCTCATCCTTCACCGCCATGACAAGAAT
TGGATCGTGCCGTTTCTGCTATGGCTGGCCATCACCCTCCGCCTCGTCTTCTACTACGTTCCCATCCGGTACGTG
TCCGGGCCGATCCGCTGGCTATGGCGCCACTCAGCGCTCGTCGTGTACGATGCCGTACCGTCTCGCTTCCGGACT
CTGGTCGGCGGCCTCGCTGCCGTTGCCGTCGTCCTCGTCGGCTCCTTCGTTACGGAGGAGAGCGCGGATAACACG
CGAGCTAACCGGGCTGTAAGCCTCTTTGGCATGGCCGTCATCCTCTTGGCTTTTTACCTGACGAGCGCGGCTCGA
CGGCGCATCAACTGGCGGACCGTCATCGTCGGCATGCTGACGCAGTACATCATCGGTCTCTTCGTCCTGCGTACC
TCGGTGGGCTATGACATCTTCAAGTTCATCGCCGAGAGGGCCGGCGATCTGCTCGGCTTCGCAAAGGACGGTGTT
GGCTTCCTGACGACTCCCGACGTGGCCCGTCTCCCATGGTTCCTACTCGGCGTCGTCCCGGCCATCATCTTCTTC
ATCTCGCTCGTGCAGGTGCTCTATCACATCGGCTTCCTACAGTGGTTCATCCGCAAGTTCGCAACCTTTGTCTTC
TGGGCCATGGGCGTCTCCGGCGCAGAGGCCGTCGTCGCCGCTGCGACGCCCTTTATCGGCCAGGGCGAGTCGGCC
ATGCTGGTCCGCCCCTTTGTGCCGCACATGACGCGCGCGGAGATTCACCAGATCCTCACCTGCGGCTTCGCCACC
ATCTCGGGCTCCGTCCTCGTCGGCTACATCGGCCTGGGCCTCAACCCGGAAGCCCTCGTCTCGTCATGCATCATG
TCCATCCCCGCCTCACTCGCCATCTCCAAGCTGCGCTACCCGGAGACGGAGGAGACGCTGACGGCCGGTCGGGTC
GTGCTGCCCGACGACGAGGACAACAAGGCCGAGAACGGGCTTCATGCCTTTGCCAACGGCGCCTGGCTGGGCATC
AAGATTGGCGGCACAATCATTGCCTCTCTGCTGTGCATCCTGGCTGCTGTCGGGCTCGTCAACGGCCTGCTGTCG
TGGTGGGGGCGATATCTCGACATCAACGACCCGCAGTTGACGCTACAGACCATCTTATCCTACGTGTTTTACCCC
GTCGCCTTTCTCCTCGGCGTCCCGCGCAACGGCGACCTCCTCAAGGTGGCCAAGCTGATAGCCGAAAAGGTAGTG
ACGAACGAATACAACGCCTTCACCAAACTCGCCCACGACCCCGAATACGCCAACCTCTCAGCCCGCTCCCAGCTC
ATCGCCACCTACGCCGTCTGCGGCTTCGGCAACATCGGCTCCCTCGGCATCCAGATCGGCATCCTCGGCCAGCTC
GCCCCCTCGCGCGGAGGAGACGTCTCGAGGCTCGCCCTCTCGGCCCTCGTCTCGGGCGTCATGTCGACGCTCACC
TCGGCCACCGTCGCCGGCCTCGTCGTCACCACTCAGATCTCCAACTTTACTCGCGGGGGGGCTTCTTCGTGA
Gene >Ophcf2|00643
ATGGTCGCTGCTCACCTCGACTCGGCCCGCGACGGCCCCGCCCGGACCTCCGACGCCGACTACAAGGCCGAGAAG
ACGGACGTGCCGACGGCGGACTTTGGGGATGCCGAGAAGGGAGAGGCTGGTCAGGGTTCGACGGAGCTGACTTCG
GCGCCTGGTGATGATGCCGTCGCTGGCAGGTCTCGCTTCGGACGTCTCGATAGTAGCCGCCATCGTCGCATCTTG
GTTCACATCGTCATCTTCCTCGTCTTTACCGGCTGGTGGATCGCCTCGCTCATCCTTCACCGCCATGACAAGAAT
TGGATCGTGCCGTTTCTGCTATGGCTGGCCATCACCCTCCGCCTCGTCTTCTACTACGTTCCCATCCGGTACGTG
TCCGGGCCGATCCGCTGGCTATGGCGCCACTCAGCGCTCGTCGTGTACGATGCCGTACCGTCTCGCTTCCGGACT
CTGGTCGGCGGCCTCGCTGCCGTTGCCGTCGTCCTCGTCGGCTCCTTCGTTACGGAGGAGAGCGCGGATAACACG
CGAGCTAACCGGGCTGTAAGCCTCTTTGGCATGGCCGTCATCCTCTTGGCTTTTTACCTGACGAGCGCGGCTCGA
CGGCGCATCAACTGGCGGACCGTCATCGTCGGCATGCTGACGCAGTACATCATCGGTCTCTTCGTCCTGCGTACC
TCGGTGGGCTATGACATCTTCAAGTTCATCGCCGAGAGGGCCGGCGATCTGCTCGGCTTCGCAAAGGACGGTGTT
GGCTTCCTGACGACTCCCGACGTGGCCCGTCTCCCATGGTTCCTACTCGGCGTCGTCCCGGCCATCATCTTCTTC
ATCTCGCTCGTGCAGGTGCTCTATCACATCGGCTTCCTACAGTGGTTCATCCGCAAGTTCGCAACCTTTGTCTTC
TGGGCCATGGGCGTCTCCGGCGCAGAGGCCGTCGTCGCCGCTGCGACGCCCTTTATCGGCCAGGGCGAGTCGGCC
ATGCTGGTCCGCCCCTTTGTGCCGCACATGACGCGCGCGGAGATTCACCAGATCCTCACCTGCGGCTTCGCCACC
ATCTCGGGCTCCGTCCTCGTCGGCTACATCGGCCTGGGCCTCAACCCGGAAGCCCTCGTCTCGTCATGCATCATG
TCCATCCCCGCCTCACTCGCCATCTCCAAGCTGCGCTACCCGGAGACGGAGGAGACGCTGACGGCCGGTCGGGTC
GTGCTGCCCGACGACGAGGACAACAAGGCCGAGAACGGGCTTCATGCCTTTGCCAACGGCGCCTGGCTGGGCATC
AAGATTGGCGGCACAATCATTGCCTCTCTGCTGTGCATCCTGGCTGCTGTCGGGCTCGTCAACGGCCTGCTGTCG
TGGTGGGGGCGATATCTCGACATCAACGACCCGCAGTTGACGCTACAGACCATCTTATCCTACGTGTTTTACCCC
GTCGCCTTTCTCCTCGGCGTCCCGCGCAACGGCGACCTCCTCAAGGTGGCCAAGCTGATAGCCGAAAAGGTAGTG
ACGGTAAGCCTCATCTTCCTCCTCTTCCTCTTCTTTCTCCTCCTCTTCCTTCTCCTCTTCCTTCTCTTCTTCCTC
CTCCTCCTCCTCCTCCTCCATCCCCCCCCCCCACCCCCCTCATCTCCATCATCTACACTCGCTCACAAAACAAAC
GCCCAGAACGAATACAACGCCTTCACCAAACTCGCCCACGACCCCGAATACGCCAACCTCTCAGCCCGCTCCCAG
CTCATCGCCACCTACGCCGTCTGCGGCTTCGGCAACATCGGCTCCCTCGGCATCCAGATCGGCATCCTCGGCCAG
CTCGCCCCCTCGCGCGGAGGAGACGTCTCGAGGCTCGCCCTCTCGGCCCTCGTCTCGGGCGTCATGTCGACGCTC
ACCTCGGCCACCGTCGCCGGCCTCGTCGTCACCACTCAGATCTCCAACTTTACTCGCGGGGGGGCTTCTTCGTGA

© 2022 - Robin Ohm - Utrecht University - The Netherlands

Built with Python Django and Wagtail