Fungal Genomics

at Utrecht University

General Properties

Protein IDOphcf2|00628
Gene name
Locationscaffold_01:2440442..2441111
Strand+
Gene length (bp)669
Transcript length (bp)669
Coding sequence length (bp)669
Protein length (aa) 223

Overview

Your browser does not support drawing a protein figure.

PFAM Domains

PFAM Domain ID Short name Long name E-value Start End
PF08609 Fes1 Nucleotide exchange factor Fes1 1.6E-32 6 100
PF13513 HEAT_EZ HEAT-like repeat 2.2E-05 119 173

GO

(None)

Deeploc

[Help with interpreting the results of Deeploc 2.0]
Localizations Signals Cytoplasm Nucleus Extracellular Cell membrane Mitochondrion Plastid Endoplasmic reticulum Lysosome vacuole Golgi apparatus Peroxisome
Cytoplasm Nuclear export signal 0.7072 0.4758 0.0669 0.0383 0.2376 0.0059 0.1609 0.0871 0.4191 0.0901

SignalP

(None)

Transmembrane Domains

(None)

Transcription Factor Class

(None)

CAZymes

(None)

Secondary Metabolism

(None)

Expression data

Analysis 1: Expression analysis during behavioral modification. Published in: Will et al., G3, 2020

Click here for more information

Orthologs

Orthofinder run ID4
Orthogroup3663
Change Orthofinder run
Species Protein ID
Ophiocordyceps australis 1348a (Ghana) OphauG2|2697
Ophiocordyceps australis map64 (Brazil) OphauB2|3530
Ophiocordyceps camponoti-floridani Ophcf2|00628 (this protein)
Ophiocordyceps camponoti-rufipedis Ophun1|7022
Ophiocordyceps kimflemingae Ophio5|5180
Ophiocordyceps subramaniannii Hirsu2|7077

Sequences

Type of sequenceSequence
Locus Download genbank file of locus Download genbank file of locus (reverse complement)
The gene with 5 kb flanks (if sufficient flanking sequence is available). For use in cloning design programs. NOTE: features (genes or exons) that are only partially contained within the sequence are completely excluded.
Protein >Ophcf2|00628
MGDKRLNDLLRWGIENSEAPANSATSTTNTRNNADPSHGSNLTPDVMAALMGGPSDADLMKAAMEVIGAPLSDQV
SLDDKLIAFDNFEQLIESLDNANNMANLSLWTPLLDQLRSDEAELRKMAAWCVGTAVQNNERTQEKLLAMGGLPP
LVAMSVNSDERTDVRRKAVYALSSACRNYQPAMDVCVEELSKNGYAPNKVDANEMEAVDEVMNGLREKAGAA*
Coding >Ophcf2|00628
ATGGGGGATAAACGCCTCAACGATCTTCTCCGCTGGGGCATTGAAAACTCTGAGGCCCCCGCAAACAGCGCCACA
AGCACGACAAACACGAGAAACAACGCCGATCCCTCTCATGGCTCGAACCTCACCCCCGACGTCATGGCCGCCTTG
ATGGGCGGCCCCTCAGACGCCGATCTCATGAAGGCCGCCATGGAAGTCATCGGCGCCCCGCTCTCCGACCAAGTC
TCTCTCGACGACAAGCTCATCGCCTTTGACAACTTCGAGCAGCTCATCGAGAGCCTCGACAACGCAAACAACATG
GCGAACCTTAGCCTCTGGACTCCGCTCCTCGACCAACTCCGCAGCGACGAGGCCGAATTGCGCAAGATGGCTGCG
TGGTGCGTTGGCACCGCCGTCCAGAACAACGAACGTACGCAGGAGAAGCTGCTCGCCATGGGCGGCCTTCCGCCT
CTCGTCGCCATGTCCGTCAACAGCGACGAGAGGACCGATGTGCGGAGGAAGGCCGTCTATGCCCTGAGCTCGGCG
TGCCGCAATTACCAGCCGGCAATGGACGTCTGCGTCGAGGAACTGTCCAAGAACGGATACGCTCCGAACAAGGTC
GATGCGAACGAAATGGAGGCCGTCGACGAGGTCATGAATGGCTTACGCGAAAAGGCGGGCGCCGCTTAG
Transcript >Ophcf2|00628
ATGGGGGATAAACGCCTCAACGATCTTCTCCGCTGGGGCATTGAAAACTCTGAGGCCCCCGCAAACAGCGCCACA
AGCACGACAAACACGAGAAACAACGCCGATCCCTCTCATGGCTCGAACCTCACCCCCGACGTCATGGCCGCCTTG
ATGGGCGGCCCCTCAGACGCCGATCTCATGAAGGCCGCCATGGAAGTCATCGGCGCCCCGCTCTCCGACCAAGTC
TCTCTCGACGACAAGCTCATCGCCTTTGACAACTTCGAGCAGCTCATCGAGAGCCTCGACAACGCAAACAACATG
GCGAACCTTAGCCTCTGGACTCCGCTCCTCGACCAACTCCGCAGCGACGAGGCCGAATTGCGCAAGATGGCTGCG
TGGTGCGTTGGCACCGCCGTCCAGAACAACGAACGTACGCAGGAGAAGCTGCTCGCCATGGGCGGCCTTCCGCCT
CTCGTCGCCATGTCCGTCAACAGCGACGAGAGGACCGATGTGCGGAGGAAGGCCGTCTATGCCCTGAGCTCGGCG
TGCCGCAATTACCAGCCGGCAATGGACGTCTGCGTCGAGGAACTGTCCAAGAACGGATACGCTCCGAACAAGGTC
GATGCGAACGAAATGGAGGCCGTCGACGAGGTCATGAATGGCTTACGCGAAAAGGCGGGCGCCGCTTAG
Gene >Ophcf2|00628
ATGGGGGATAAACGCCTCAACGATCTTCTCCGCTGGGGCATTGAAAACTCTGAGGCCCCCGCAAACAGCGCCACA
AGCACGACAAACACGAGAAACAACGCCGATCCCTCTCATGGCTCGAACCTCACCCCCGACGTCATGGCCGCCTTG
ATGGGCGGCCCCTCAGACGCCGATCTCATGAAGGCCGCCATGGAAGTCATCGGCGCCCCGCTCTCCGACCAAGTC
TCTCTCGACGACAAGCTCATCGCCTTTGACAACTTCGAGCAGCTCATCGAGAGCCTCGACAACGCAAACAACATG
GCGAACCTTAGCCTCTGGACTCCGCTCCTCGACCAACTCCGCAGCGACGAGGCCGAATTGCGCAAGATGGCTGCG
TGGTGCGTTGGCACCGCCGTCCAGAACAACGAACGTACGCAGGAGAAGCTGCTCGCCATGGGCGGCCTTCCGCCT
CTCGTCGCCATGTCCGTCAACAGCGACGAGAGGACCGATGTGCGGAGGAAGGCCGTCTATGCCCTGAGCTCGGCG
TGCCGCAATTACCAGCCGGCAATGGACGTCTGCGTCGAGGAACTGTCCAAGAACGGATACGCTCCGAACAAGGTC
GATGCGAACGAAATGGAGGCCGTCGACGAGGTCATGAATGGCTTACGCGAAAAGGCGGGCGCCGCTTAG

© 2023 - Robin Ohm - Utrecht University - The Netherlands

Built with Python Django and Wagtail