Fungal Genomics

at Utrecht University

General Properties

Protein IDOphcf2|00619
Gene name
Locationscaffold_01:2408021..2411675
Strand+
Gene length (bp)3654
Transcript length (bp)3567
Coding sequence length (bp)3567
Protein length (aa) 1189

Overview

Your browser does not support drawing a protein figure.

PFAM Domains

PFAM Domain ID Short name Long name E-value Start End
PF01841 Transglut_core Transglutaminase-like superfamily 2.3E-08 723 819
PF07653 SH3_2 Variant SH3 domain 4.8E-06 15 70

GO

GO Term Description Terminal node
GO:0005515 protein binding Yes
GO:0005488 binding No
GO:0003674 molecular_function No

Deeploc

[Help with interpreting the results of Deeploc 2.0]
Localizations Signals Cytoplasm Nucleus Extracellular Cell membrane Mitochondrion Plastid Endoplasmic reticulum Lysosome vacuole Golgi apparatus Peroxisome
Cytoplasm Nuclear localization signal 0.6261 0.4356 0.1061 0.249 0.0459 0.0056 0.2163 0.1525 0.1029 0.0022

SignalP

(None)

Transmembrane Domains

(None)

Transcription Factor Class

(None)

CAZymes

(None)

Secondary Metabolism

(None)

Expression data

Analysis 1: Expression analysis during behavioral modification. Published in: Will et al., G3, 2020

Click here for more information

Orthologs

Orthofinder run ID4
Orthogroup3051
Change Orthofinder run
Species Protein ID
Ophiocordyceps australis 1348a (Ghana) OphauG2|5222
Ophiocordyceps australis map64 (Brazil) OphauB2|3596
Ophiocordyceps camponoti-floridani Ophcf2|00619 (this protein)
Ophiocordyceps camponoti-rufipedis Ophun1|2972
Ophiocordyceps kimflemingae Ophio5|3111
Ophiocordyceps subramaniannii Hirsu2|5286

Sequences

Type of sequenceSequence
Locus Download genbank file of locus Download genbank file of locus (reverse complement)
The gene with 5 kb flanks (if sufficient flanking sequence is available). For use in cloning design programs. NOTE: features (genes or exons) that are only partially contained within the sequence are completely excluded.
Protein >Ophcf2|00619
MVPAPPMLPAQFPCWCRAIYSWGGESKRDLGFIEGDLIECLNAGDGSWWVGRLYRDRRTVGSFPSNFVEVLPDGF
RPAARSVSPMPDRASSSPKAMTSKSITFRKPFEAYAKAPHYTSAKQPETFRDPPRPRTREETAPRSIHDGIDNVP
SPPPGRGYGSRAPSPMPSPSPSPVPSMRYESRTPIDDGASPPPPPPPPHRHIRQNGSQDMLPEGYHPVARHGSTA
SYSHYRQGSGDSYQAPHHLSRHPSHVGYSDAPHDVRPCTPRAPSPRPPSPASSHMTPSPLREAMDGVIEQLGQLG
GFRERCSQEPLSPEETPVDPWSPESFDLTTPRSRRPPPENARPVTSMGIAHHDEGYETWSGESSRGVSNYGGHGE
VNRLNSYVQRMENQLRRGHAASFDAPVGDMGPPPPPPPKGHPYDRPKTSSGEAMVLERESLRARKSAYEVGRGVG
RTYTTKTNVTNASSGNQSNASASTQSSGRTLWSGTSASAFSATSAGSFSRTHARAQSALGMRELDMDRPETPFTG
VTYHSSHASNANDVRPASQAAVHDDLGAGLGGLVQPKAPKRNIFRKMFDSAKTGVASNRISISAAGSGSSPFSRQ
NSSPVSSKTRTMAETAQRDTSGVDWVQVRRDVNRSNSLSKIERDERRDRCQMMDYPALNPVDELLDSIEGDEGAD
GMPVTSPLNYQAINFAQVDKNSRFIGEPPPMTTAATLATAYVCRPFRSEVQRLRAIFTWVAERICWEQEAEGAAD
SRRVIETKRACAEEYAALVLDLCAAAGLVCEMVRGFLKSPGDVLDPTMAPRSNHWWNAVVVDGEWRMMDCCLASP
SNPKRGLYSSVSGASADFWWFLTRPSELCWTHVPEHHDQQHMVPPVAHEVLLNLPCACPALFRHGIELVDFNTAA
TRIEDLEMVHIKLNVPADVEVAAEVEARALCRDSDGDVFESGDRIRKRALAQAEWTGGVKRYVVKALLPGDEGHG
TLKIYAGKRGLMQSIKDIPHPLALALPVVHLGENPPYEFVTRHPTPHAQRHDIYVVQPQCQRLALNNTFVFAIRQ
HPSTLATGCGPLTPASNPGATSPVPYARPSSAMSMAASSSVSNPSSSATGIVAGKKPAKLAIQTPGGKILRLMRK
EERRGVGGRPATAGGNGVDGEDATDGGTWETIIKCSERGLWRGLVLADRTARWCVFAEWVCVG*
Coding >Ophcf2|00619
ATGGTTCCTGCTCCGCCGATGCTTCCGGCTCAGTTCCCCTGCTGGTGCCGGGCCATTTATTCCTGGGGAGGCGAG
TCCAAACGTGACCTCGGCTTTATCGAAGGCGACCTCATTGAGTGTCTTAACGCTGGCGATGGGTCCTGGTGGGTT
GGCCGACTCTATCGTGATCGAAGGACTGTCGGCTCGTTCCCGTCCAACTTCGTCGAGGTCCTTCCGGACGGGTTT
CGACCAGCAGCTAGGTCCGTCAGCCCGATGCCGGATCGAGCCTCATCCAGCCCAAAAGCCATGACGTCCAAATCC
ATAACGTTTCGCAAGCCCTTCGAGGCCTACGCCAAAGCGCCGCATTATACCAGCGCCAAGCAGCCAGAGACCTTC
CGGGACCCTCCCAGGCCCCGGACCAGGGAAGAGACTGCCCCTAGAAGCATTCACGATGGCATCGATAATGTGCCG
TCTCCCCCTCCAGGTCGTGGTTACGGATCGCGAGCCCCGTCGCCCATGCCGTCGCCATCACCGTCTCCCGTGCCG
TCCATGAGGTATGAATCTCGCACCCCGATCGACGACGGGGCCTCTCCTCCTCCGCCTCCGCCGCCACCACATCGT
CATATCCGCCAGAACGGGTCCCAGGACATGCTTCCCGAAGGCTACCACCCCGTAGCCCGGCACGGCTCGACAGCT
TCCTATAGTCATTACCGCCAAGGGTCTGGCGACTCGTATCAAGCGCCGCATCATCTCTCGAGACATCCGTCGCAC
GTCGGATACTCCGATGCGCCGCATGACGTCCGCCCTTGCACTCCCCGAGCTCCGTCCCCGAGGCCACCATCACCG
GCGAGCAGCCACATGACGCCGTCGCCGCTACGAGAGGCAATGGACGGCGTCATCGAGCAGCTGGGCCAACTGGGC
GGCTTCAGAGAAAGATGCAGCCAAGAGCCGTTATCACCGGAAGAAACACCCGTGGATCCCTGGTCTCCCGAGTCG
TTCGACTTGACGACGCCGCGATCTAGACGCCCGCCGCCCGAAAACGCGAGGCCGGTGACATCGATGGGCATCGCT
CATCATGACGAGGGATACGAGACCTGGAGTGGCGAGTCCAGTCGGGGAGTCTCGAACTACGGCGGACATGGTGAG
GTCAATCGTCTGAACAGCTACGTGCAGAGAATGGAGAATCAGCTTCGGCGAGGTCACGCTGCCAGCTTCGACGCG
CCCGTGGGAGACATGGGACCTCCGCCACCTCCTCCGCCCAAGGGCCACCCATACGATAGGCCCAAGACGTCGTCC
GGGGAGGCCATGGTGCTGGAAAGGGAGTCTCTGCGGGCTCGCAAGTCTGCCTATGAGGTAGGTCGCGGCGTCGGG
AGGACCTACACGACCAAGACCAACGTCACCAATGCCTCATCCGGCAACCAGAGCAACGCCAGCGCCTCGACGCAG
AGCAGTGGCCGGACGCTATGGAGCGGCACGTCGGCCAGCGCCTTCAGTGCCACCAGCGCCGGGAGCTTCTCGCGG
ACGCACGCCCGTGCCCAGAGCGCGCTGGGCATGCGCGAGCTCGACATGGATCGGCCGGAGACGCCCTTCACCGGC
GTCACCTACCACAGCAGCCATGCCAGTAACGCGAACGACGTCCGTCCGGCCTCGCAGGCAGCCGTCCACGACGAT
CTCGGGGCCGGCCTTGGCGGTCTTGTCCAGCCCAAGGCACCGAAGCGGAACATCTTTCGTAAGATGTTCGACTCG
GCCAAGACGGGCGTGGCCAGCAATCGCATCAGCATCTCGGCCGCCGGTTCGGGCTCATCGCCCTTTTCCCGGCAG
AATTCGTCTCCCGTGTCGAGTAAGACGAGGACGATGGCCGAGACGGCGCAGAGAGACACGAGCGGCGTCGACTGG
GTACAGGTGCGTCGCGATGTCAACCGATCCAACTCGCTCAGCAAGATTGAGCGGGACGAGAGGAGAGATCGGTGT
CAGATGATGGACTACCCGGCCCTCAATCCCGTCGATGAGCTGCTAGACAGCATCGAGGGAGATGAGGGTGCCGAC
GGGATGCCCGTGACGTCTCCTCTCAACTATCAGGCCATCAACTTCGCCCAGGTGGACAAGAACTCGCGCTTCATC
GGCGAGCCGCCGCCCATGACGACGGCGGCGACGCTGGCCACGGCCTACGTCTGCCGGCCCTTTCGGAGCGAGGTG
CAGCGGCTGCGTGCCATCTTTACCTGGGTGGCCGAGCGCATCTGCTGGGAGCAAGAGGCCGAGGGCGCGGCCGAC
AGCAGGCGCGTCATCGAGACGAAACGGGCGTGCGCCGAGGAGTACGCGGCCCTCGTGCTGGACCTTTGCGCCGCG
GCTGGGCTCGTGTGCGAGATGGTACGAGGCTTCCTCAAGAGCCCTGGCGACGTGCTGGACCCGACCATGGCGCCT
CGATCCAACCACTGGTGGAATGCTGTCGTGGTCGACGGGGAATGGCGCATGATGGACTGCTGCCTGGCCAGCCCA
TCGAACCCGAAGCGAGGTCTGTACTCGAGCGTCAGTGGCGCCTCGGCCGACTTCTGGTGGTTCTTGACCCGGCCT
TCGGAGCTGTGCTGGACGCACGTGCCCGAGCATCACGATCAGCAGCACATGGTGCCTCCCGTTGCACACGAAGTG
CTACTGAACCTGCCGTGCGCCTGCCCAGCACTGTTCCGGCACGGCATCGAGCTTGTCGACTTCAACACGGCCGCA
ACCCGCATCGAGGACCTCGAGATGGTGCATATCAAGCTCAACGTGCCAGCCGACGTCGAGGTGGCAGCCGAGGTA
GAGGCTCGCGCCCTGTGTCGGGACTCGGACGGCGACGTCTTCGAGAGCGGCGATCGGATCCGCAAGCGGGCGCTG
GCTCAGGCCGAGTGGACGGGCGGCGTCAAGCGATACGTCGTCAAGGCCCTGCTTCCAGGAGACGAGGGCCACGGC
ACGCTCAAGATATATGCTGGCAAGCGGGGGTTGATGCAAAGCATCAAAGACATCCCGCATCCGCTGGCACTGGCG
CTTCCTGTCGTCCATTTGGGCGAGAACCCGCCGTATGAATTTGTGACGCGGCATCCGACGCCGCACGCGCAGCGC
CACGACATCTACGTGGTGCAGCCTCAGTGCCAGCGACTGGCGCTCAACAACACCTTTGTCTTCGCCATCCGCCAG
CATCCGAGCACGCTGGCCACCGGGTGCGGACCTCTGACTCCGGCTTCGAACCCGGGCGCGACGAGCCCCGTGCCT
TACGCGCGGCCATCTTCGGCCATGAGCATGGCCGCCTCGTCCAGCGTCTCTAACCCGAGCTCATCGGCCACCGGC
ATCGTCGCCGGTAAGAAGCCGGCCAAGCTGGCCATCCAGACGCCCGGCGGCAAGATCCTTCGCTTGATGAGAAAG
GAAGAGCGACGCGGCGTCGGCGGGAGGCCAGCAACGGCGGGAGGCAATGGCGTCGACGGTGAAGATGCGACCGAC
GGCGGCACGTGGGAGACTATCATCAAGTGCTCCGAGAGGGGACTCTGGCGCGGCTTGGTGCTGGCAGACCGAACG
GCGCGCTGGTGCGTCTTTGCCGAATGGGTCTGTGTCGGTTAA
Transcript >Ophcf2|00619
ATGGTTCCTGCTCCGCCGATGCTTCCGGCTCAGTTCCCCTGCTGGTGCCGGGCCATTTATTCCTGGGGAGGCGAG
TCCAAACGTGACCTCGGCTTTATCGAAGGCGACCTCATTGAGTGTCTTAACGCTGGCGATGGGTCCTGGTGGGTT
GGCCGACTCTATCGTGATCGAAGGACTGTCGGCTCGTTCCCGTCCAACTTCGTCGAGGTCCTTCCGGACGGGTTT
CGACCAGCAGCTAGGTCCGTCAGCCCGATGCCGGATCGAGCCTCATCCAGCCCAAAAGCCATGACGTCCAAATCC
ATAACGTTTCGCAAGCCCTTCGAGGCCTACGCCAAAGCGCCGCATTATACCAGCGCCAAGCAGCCAGAGACCTTC
CGGGACCCTCCCAGGCCCCGGACCAGGGAAGAGACTGCCCCTAGAAGCATTCACGATGGCATCGATAATGTGCCG
TCTCCCCCTCCAGGTCGTGGTTACGGATCGCGAGCCCCGTCGCCCATGCCGTCGCCATCACCGTCTCCCGTGCCG
TCCATGAGGTATGAATCTCGCACCCCGATCGACGACGGGGCCTCTCCTCCTCCGCCTCCGCCGCCACCACATCGT
CATATCCGCCAGAACGGGTCCCAGGACATGCTTCCCGAAGGCTACCACCCCGTAGCCCGGCACGGCTCGACAGCT
TCCTATAGTCATTACCGCCAAGGGTCTGGCGACTCGTATCAAGCGCCGCATCATCTCTCGAGACATCCGTCGCAC
GTCGGATACTCCGATGCGCCGCATGACGTCCGCCCTTGCACTCCCCGAGCTCCGTCCCCGAGGCCACCATCACCG
GCGAGCAGCCACATGACGCCGTCGCCGCTACGAGAGGCAATGGACGGCGTCATCGAGCAGCTGGGCCAACTGGGC
GGCTTCAGAGAAAGATGCAGCCAAGAGCCGTTATCACCGGAAGAAACACCCGTGGATCCCTGGTCTCCCGAGTCG
TTCGACTTGACGACGCCGCGATCTAGACGCCCGCCGCCCGAAAACGCGAGGCCGGTGACATCGATGGGCATCGCT
CATCATGACGAGGGATACGAGACCTGGAGTGGCGAGTCCAGTCGGGGAGTCTCGAACTACGGCGGACATGGTGAG
GTCAATCGTCTGAACAGCTACGTGCAGAGAATGGAGAATCAGCTTCGGCGAGGTCACGCTGCCAGCTTCGACGCG
CCCGTGGGAGACATGGGACCTCCGCCACCTCCTCCGCCCAAGGGCCACCCATACGATAGGCCCAAGACGTCGTCC
GGGGAGGCCATGGTGCTGGAAAGGGAGTCTCTGCGGGCTCGCAAGTCTGCCTATGAGGTAGGTCGCGGCGTCGGG
AGGACCTACACGACCAAGACCAACGTCACCAATGCCTCATCCGGCAACCAGAGCAACGCCAGCGCCTCGACGCAG
AGCAGTGGCCGGACGCTATGGAGCGGCACGTCGGCCAGCGCCTTCAGTGCCACCAGCGCCGGGAGCTTCTCGCGG
ACGCACGCCCGTGCCCAGAGCGCGCTGGGCATGCGCGAGCTCGACATGGATCGGCCGGAGACGCCCTTCACCGGC
GTCACCTACCACAGCAGCCATGCCAGTAACGCGAACGACGTCCGTCCGGCCTCGCAGGCAGCCGTCCACGACGAT
CTCGGGGCCGGCCTTGGCGGTCTTGTCCAGCCCAAGGCACCGAAGCGGAACATCTTTCGTAAGATGTTCGACTCG
GCCAAGACGGGCGTGGCCAGCAATCGCATCAGCATCTCGGCCGCCGGTTCGGGCTCATCGCCCTTTTCCCGGCAG
AATTCGTCTCCCGTGTCGAGTAAGACGAGGACGATGGCCGAGACGGCGCAGAGAGACACGAGCGGCGTCGACTGG
GTACAGGTGCGTCGCGATGTCAACCGATCCAACTCGCTCAGCAAGATTGAGCGGGACGAGAGGAGAGATCGGTGT
CAGATGATGGACTACCCGGCCCTCAATCCCGTCGATGAGCTGCTAGACAGCATCGAGGGAGATGAGGGTGCCGAC
GGGATGCCCGTGACGTCTCCTCTCAACTATCAGGCCATCAACTTCGCCCAGGTGGACAAGAACTCGCGCTTCATC
GGCGAGCCGCCGCCCATGACGACGGCGGCGACGCTGGCCACGGCCTACGTCTGCCGGCCCTTTCGGAGCGAGGTG
CAGCGGCTGCGTGCCATCTTTACCTGGGTGGCCGAGCGCATCTGCTGGGAGCAAGAGGCCGAGGGCGCGGCCGAC
AGCAGGCGCGTCATCGAGACGAAACGGGCGTGCGCCGAGGAGTACGCGGCCCTCGTGCTGGACCTTTGCGCCGCG
GCTGGGCTCGTGTGCGAGATGGTACGAGGCTTCCTCAAGAGCCCTGGCGACGTGCTGGACCCGACCATGGCGCCT
CGATCCAACCACTGGTGGAATGCTGTCGTGGTCGACGGGGAATGGCGCATGATGGACTGCTGCCTGGCCAGCCCA
TCGAACCCGAAGCGAGGTCTGTACTCGAGCGTCAGTGGCGCCTCGGCCGACTTCTGGTGGTTCTTGACCCGGCCT
TCGGAGCTGTGCTGGACGCACGTGCCCGAGCATCACGATCAGCAGCACATGGTGCCTCCCGTTGCACACGAAGTG
CTACTGAACCTGCCGTGCGCCTGCCCAGCACTGTTCCGGCACGGCATCGAGCTTGTCGACTTCAACACGGCCGCA
ACCCGCATCGAGGACCTCGAGATGGTGCATATCAAGCTCAACGTGCCAGCCGACGTCGAGGTGGCAGCCGAGGTA
GAGGCTCGCGCCCTGTGTCGGGACTCGGACGGCGACGTCTTCGAGAGCGGCGATCGGATCCGCAAGCGGGCGCTG
GCTCAGGCCGAGTGGACGGGCGGCGTCAAGCGATACGTCGTCAAGGCCCTGCTTCCAGGAGACGAGGGCCACGGC
ACGCTCAAGATATATGCTGGCAAGCGGGGGTTGATGCAAAGCATCAAAGACATCCCGCATCCGCTGGCACTGGCG
CTTCCTGTCGTCCATTTGGGCGAGAACCCGCCGTATGAATTTGTGACGCGGCATCCGACGCCGCACGCGCAGCGC
CACGACATCTACGTGGTGCAGCCTCAGTGCCAGCGACTGGCGCTCAACAACACCTTTGTCTTCGCCATCCGCCAG
CATCCGAGCACGCTGGCCACCGGGTGCGGACCTCTGACTCCGGCTTCGAACCCGGGCGCGACGAGCCCCGTGCCT
TACGCGCGGCCATCTTCGGCCATGAGCATGGCCGCCTCGTCCAGCGTCTCTAACCCGAGCTCATCGGCCACCGGC
ATCGTCGCCGGTAAGAAGCCGGCCAAGCTGGCCATCCAGACGCCCGGCGGCAAGATCCTTCGCTTGATGAGAAAG
GAAGAGCGACGCGGCGTCGGCGGGAGGCCAGCAACGGCGGGAGGCAATGGCGTCGACGGTGAAGATGCGACCGAC
GGCGGCACGTGGGAGACTATCATCAAGTGCTCCGAGAGGGGACTCTGGCGCGGCTTGGTGCTGGCAGACCGAACG
GCGCGCTGGTGCGTCTTTGCCGAATGGGTCTGTGTCGGTTAA
Gene >Ophcf2|00619
ATGGTTCCTGCTCCGCCGATGCTTCCGGCTCAGTTCCCCTGCTGGTGCCGGGCCATTTATTCCTGGGGAGGCGAG
GTCAGTGTTTAACTACCTATTTCTTCTTCGGCTTCCCCTTTCCCCATCCTCCTTTCGTCCCTGTTCGCTAATCGC
AAAAGTAAACAGTCCAAACGTGACCTCGGCTTTATCGAAGGCGACCTCATTGAGTGTCTTAACGCTGGCGATGGG
TCCTGGTGGGTTGGCCGACTCTATCGTGATCGAAGGACTGTCGGCTCGTTCCCGTCCAACTTCGTCGAGGTCCTT
CCGGACGGGTTTCGACCAGCAGCTAGGTCCGTCAGCCCGATGCCGGATCGAGCCTCATCCAGCCCAAAAGCCATG
ACGTCCAAATCCATAACGTTTCGCAAGCCCTTCGAGGCCTACGCCAAAGCGCCGCATTATACCAGCGCCAAGCAG
CCAGAGACCTTCCGGGACCCTCCCAGGCCCCGGACCAGGGAAGAGACTGCCCCTAGAAGCATTCACGATGGCATC
GATAATGTGCCGTCTCCCCCTCCAGGTCGTGGTTACGGATCGCGAGCCCCGTCGCCCATGCCGTCGCCATCACCG
TCTCCCGTGCCGTCCATGAGGTATGAATCTCGCACCCCGATCGACGACGGGGCCTCTCCTCCTCCGCCTCCGCCG
CCACCACATCGTCATATCCGCCAGAACGGGTCCCAGGACATGCTTCCCGAAGGCTACCACCCCGTAGCCCGGCAC
GGCTCGACAGCTTCCTATAGTCATTACCGCCAAGGGTCTGGCGACTCGTATCAAGCGCCGCATCATCTCTCGAGA
CATCCGTCGCACGTCGGATACTCCGATGCGCCGCATGACGTCCGCCCTTGCACTCCCCGAGCTCCGTCCCCGAGG
CCACCATCACCGGCGAGCAGCCACATGACGCCGTCGCCGCTACGAGAGGCAATGGACGGCGTCATCGAGCAGCTG
GGCCAACTGGGCGGCTTCAGAGAAAGATGCAGCCAAGAGCCGTTATCACCGGAAGAAACACCCGTGGATCCCTGG
TCTCCCGAGTCGTTCGACTTGACGACGCCGCGATCTAGACGCCCGCCGCCCGAAAACGCGAGGCCGGTGACATCG
ATGGGCATCGCTCATCATGACGAGGGATACGAGACCTGGAGTGGCGAGTCCAGTCGGGGAGTCTCGAACTACGGC
GGACATGGTGAGGTCAATCGTCTGAACAGCTACGTGCAGAGAATGGAGAATCAGCTTCGGCGAGGTCACGCTGCC
AGCTTCGACGCGCCCGTGGGAGACATGGGACCTCCGCCACCTCCTCCGCCCAAGGGCCACCCATACGATAGGCCC
AAGACGTCGTCCGGGGAGGCCATGGTGCTGGAAAGGGAGTCTCTGCGGGCTCGCAAGTCTGCCTATGAGGTAGGT
CGCGGCGTCGGGAGGACCTACACGACCAAGACCAACGTCACCAATGCCTCATCCGGCAACCAGAGCAACGCCAGC
GCCTCGACGCAGAGCAGTGGCCGGACGCTATGGAGCGGCACGTCGGCCAGCGCCTTCAGTGCCACCAGCGCCGGG
AGCTTCTCGCGGACGCACGCCCGTGCCCAGAGCGCGCTGGGCATGCGCGAGCTCGACATGGATCGGCCGGAGACG
CCCTTCACCGGCGTCACCTACCACAGCAGCCATGCCAGTAACGCGAACGACGTCCGTCCGGCCTCGCAGGCAGCC
GTCCACGACGATCTCGGGGCCGGCCTTGGCGGTCTTGTCCAGCCCAAGGCACCGAAGCGGAACATCTTTCGTAAG
ATGTTCGACTCGGCCAAGACGGGCGTGGCCAGCAATCGCATCAGCATCTCGGCCGCCGGTTCGGGCTCATCGCCC
TTTTCCCGGCAGAATTCGTCTCCCGTGTCGAGTAAGACGAGGACGATGGCCGAGACGGCGCAGAGAGACACGAGC
GGCGTCGACTGGGTACAGGTGCGTCGCGATGTCAACCGATCCAACTCGCTCAGCAAGATTGAGCGGGACGAGAGG
AGAGATCGGTGTCAGATGATGGACTACCCGGCCCTCAATCCCGTCGATGAGCTGCTAGACAGCATCGAGGGAGAT
GAGGGTGCCGACGGGATGCCCGTGACGTCTCCTCTCAACTATCAGGCCATCAACTTCGCCCAGGTGGACAAGAAC
TCGCGCTTCATCGGCGAGCCGCCGCCCATGACGACGGCGGCGACGCTGGCCACGGCCTACGTCTGCCGGCCCTTT
CGGAGCGAGGTGCAGCGGCTGCGTGCCATCTTTACCTGGGTGGCCGAGCGCATCTGCTGGGAGCAAGAGGCCGAG
GGCGCGGCCGACAGCAGGCGCGTCATCGAGACGAAACGGGCGTGCGCCGAGGAGTACGCGGCCCTCGTGCTGGAC
CTTTGCGCCGCGGCTGGGCTCGTGTGCGAGATGGTACGAGGCTTCCTCAAGAGCCCTGGCGACGTGCTGGACCCG
ACCATGGCGCCTCGATCCAACCACTGGTGGAATGCTGTCGTGGTCGACGGGGAATGGCGCATGATGGACTGCTGC
CTGGCCAGCCCATCGAACCCGAAGCGAGGTCTGTACTCGAGCGTCAGTGGCGCCTCGGCCGACTTCTGGTGGTTC
TTGACCCGGCCTTCGGAGCTGTGCTGGACGCACGTGCCCGAGCATCACGATCAGCAGCACATGGTGCCTCCCGTT
GCACACGAAGTGCTACTGAACCTGCCGTGCGCCTGCCCAGCACTGTTCCGGCACGGCATCGAGCTTGTCGACTTC
AACACGGCCGCAACCCGCATCGAGGACCTCGAGATGGTGCATATCAAGCTCAACGTGCCAGCCGACGTCGAGGTG
GCAGCCGAGGTAGAGGCTCGCGCCCTGTGTCGGGACTCGGACGGCGACGTCTTCGAGAGCGGCGATCGGATCCGC
AAGCGGGCGCTGGCTCAGGCCGAGTGGACGGGCGGCGTCAAGCGATACGTCGTCAAGGCCCTGCTTCCAGGAGAC
GAGGGCCACGGCACGCTCAAGATATATGCTGGCAAGCGGGGGTTGATGCAAAGCATCAAAGACATCCCGCATCCG
CTGGCACTGGCGCTTCCTGTCGTCCATTTGGGCGAGAACCCGCCGTATGAATTTGTGACGCGGCATCCGACGCCG
CACGCGCAGCGCCACGACATCTACGTGGTGCAGCCTCAGTGCCAGCGACTGGCGCTCAACAACACCTTTGTCTTC
GCCATCCGCCAGCATCCGAGCACGCTGGCCACCGGGTGCGGACCTCTGACTCCGGCTTCGAACCCGGGCGCGACG
AGCCCCGTGCCTTACGCGCGGCCATCTTCGGCCATGAGCATGGCCGCCTCGTCCAGCGTCTCTAACCCGAGCTCA
TCGGCCACCGGCATCGTCGCCGGTAAGAAGCCGGCCAAGCTGGCCATCCAGACGCCCGGCGGCAAGATCCTTCGC
TTGATGAGAAAGGAAGAGCGACGCGGCGTCGGCGGGAGGCCAGCAACGGCGGGAGGCAATGGCGTCGACGGTGAA
GATGCGACCGACGGCGGCACGTGGGAGACTATCATCAAGTGCTCCGAGAGGGGACTCTGGCGCGGCTTGGTGCTG
GCAGACCGAACGGCGCGCTGGTGCGTCTTTGCCGAATGGGTCTGTGTCGGTTAA

© 2023 - Robin Ohm - Utrecht University - The Netherlands

Built with Python Django and Wagtail