Fungal Genomics

at Utrecht University

General Properties

Protein IDOphcf2|00617
Gene name
Locationscaffold_01:2402521..2404206
Strand+
Gene length (bp)1685
Transcript length (bp)1125
Coding sequence length (bp)1125
Protein length (aa) 375

Overview

Your browser does not support drawing a protein figure.

PFAM Domains

PFAM Domain ID Short name Long name E-value Start End
PF08652 RAI1 RAI1 like PD-(D/E)XK nuclease 1.0E-25 217 283

GO

(None)

Deeploc

[Help with interpreting the results of Deeploc 2.0]
Localizations Signals Cytoplasm Nucleus Extracellular Cell membrane Mitochondrion Plastid Endoplasmic reticulum Lysosome vacuole Golgi apparatus Peroxisome
Cytoplasm 0.6217 0.4934 0.0662 0.1027 0.3277 0.0531 0.0681 0.0834 0.096 0.0033

SignalP

(None)

Transmembrane Domains

(None)

Transcription Factor Class

(None)

CAZymes

(None)

Secondary Metabolism

(None)

Expression data

Analysis 1: Expression analysis during behavioral modification. Published in: Will et al., G3, 2020

Click here for more information

Orthologs

Orthofinder run ID4
Orthogroup3053
Change Orthofinder run
Species Protein ID
Ophiocordyceps australis 1348a (Ghana) OphauG2|5775
Ophiocordyceps australis map64 (Brazil) OphauB2|3594
Ophiocordyceps camponoti-floridani Ophcf2|00617 (this protein)
Ophiocordyceps camponoti-rufipedis Ophun1|2970
Ophiocordyceps kimflemingae Ophio5|3113
Ophiocordyceps subramaniannii Hirsu2|5288

Sequences

Type of sequenceSequence
Locus Download genbank file of locus Download genbank file of locus (reverse complement)
The gene with 5 kb flanks (if sufficient flanking sequence is available). For use in cloning design programs. NOTE: features (genes or exons) that are only partially contained within the sequence are completely excluded.
Protein >Ophcf2|00617
MSSTFNILPVGRFSGASQPVKRPKEFACFSYDDQHEFHLGDSSLKWYYTPHIGADLSKGFDSFQKVDDSRDEHLD
SLLRTIVAHEKETRQRIDAHVVTWRGMMTKIMAALFEKNDGFEMNATLYQDCIFIEEHHEYKMATRRQEAQRPRR
MNGPPMEVMQFWGYKFETLATIPAPWGETSREYIEGRENQVVNNKEQYCSVVRTGIGNTILCLGGEVDAIWDSKP
ETKGAPVNWVELKTTAEIRSHGDMEAFHRKLMKYWIQSFLLGVPRIIVGFRTRDGFLSGLDNIDTHRIPDMVNSR
PNAQWNADMCVNFAAAFLQWLSTVINDQGVWRISRRPKIPFIVVHRVETTGHGDILSQEFKDWRTELANTPAKE*
Coding >Ophcf2|00617
ATGTCTTCCACTTTTAACATCCTGCCCGTCGGTCGTTTCTCCGGCGCCAGCCAGCCCGTAAAGAGACCCAAGGAA
TTTGCTTGCTTCTCGTACGATGACCAGCATGAGTTCCATCTGGGCGATTCCTCCCTCAAATGGTACTACACTCCT
CACATCGGAGCAGACCTGTCAAAGGGCTTCGATAGCTTTCAAAAGGTCGATGATTCGCGCGATGAGCATCTCGAC
AGCCTCCTTCGTACCATTGTTGCGCACGAGAAGGAGACGCGTCAGCGTATCGACGCACACGTCGTCACCTGGCGA
GGCATGATGACCAAGATCATGGCCGCTTTGTTTGAGAAGAATGACGGCTTCGAGATGAATGCGACTCTGTATCAG
GATTGCATCTTCATCGAAGAGCACCACGAATACAAGATGGCCACTCGCAGACAAGAAGCACAACGACCGCGCCGA
ATGAACGGTCCGCCAATGGAGGTGATGCAGTTTTGGGGTTACAAGTTCGAGACTCTGGCCACCATCCCCGCTCCC
TGGGGCGAGACATCGCGGGAGTATATCGAAGGCCGCGAGAACCAAGTCGTCAACAACAAGGAACAATACTGCTCC
GTCGTCCGAACCGGCATCGGAAACACCATCCTCTGTCTCGGCGGCGAGGTCGACGCCATCTGGGACTCCAAGCCC
GAAACCAAAGGCGCGCCCGTCAACTGGGTCGAGCTCAAAACAACAGCCGAGATCCGCTCACACGGCGACATGGAA
GCCTTCCACCGCAAGCTGATGAAGTACTGGATCCAGTCTTTCCTCCTCGGCGTTCCCCGAATCATCGTCGGCTTC
CGCACTCGCGATGGCTTCCTCTCCGGCCTCGACAACATCGACACCCATCGCATACCCGACATGGTCAACTCGCGT
CCCAACGCCCAGTGGAACGCCGACATGTGTGTCAACTTTGCCGCCGCCTTTCTGCAGTGGCTCTCGACCGTCATC
AACGATCAGGGTGTCTGGCGCATTTCTCGCCGCCCGAAGATCCCCTTTATCGTTGTCCACCGTGTCGAGACCACC
GGCCACGGCGATATCCTGTCCCAGGAGTTCAAGGACTGGAGGACCGAGCTCGCCAATACCCCAGCCAAGGAGTGA
Transcript >Ophcf2|00617
ATGTCTTCCACTTTTAACATCCTGCCCGTCGGTCGTTTCTCCGGCGCCAGCCAGCCCGTAAAGAGACCCAAGGAA
TTTGCTTGCTTCTCGTACGATGACCAGCATGAGTTCCATCTGGGCGATTCCTCCCTCAAATGGTACTACACTCCT
CACATCGGAGCAGACCTGTCAAAGGGCTTCGATAGCTTTCAAAAGGTCGATGATTCGCGCGATGAGCATCTCGAC
AGCCTCCTTCGTACCATTGTTGCGCACGAGAAGGAGACGCGTCAGCGTATCGACGCACACGTCGTCACCTGGCGA
GGCATGATGACCAAGATCATGGCCGCTTTGTTTGAGAAGAATGACGGCTTCGAGATGAATGCGACTCTGTATCAG
GATTGCATCTTCATCGAAGAGCACCACGAATACAAGATGGCCACTCGCAGACAAGAAGCACAACGACCGCGCCGA
ATGAACGGTCCGCCAATGGAGGTGATGCAGTTTTGGGGTTACAAGTTCGAGACTCTGGCCACCATCCCCGCTCCC
TGGGGCGAGACATCGCGGGAGTATATCGAAGGCCGCGAGAACCAAGTCGTCAACAACAAGGAACAATACTGCTCC
GTCGTCCGAACCGGCATCGGAAACACCATCCTCTGTCTCGGCGGCGAGGTCGACGCCATCTGGGACTCCAAGCCC
GAAACCAAAGGCGCGCCCGTCAACTGGGTCGAGCTCAAAACAACAGCCGAGATCCGCTCACACGGCGACATGGAA
GCCTTCCACCGCAAGCTGATGAAGTACTGGATCCAGTCTTTCCTCCTCGGCGTTCCCCGAATCATCGTCGGCTTC
CGCACTCGCGATGGCTTCCTCTCCGGCCTCGACAACATCGACACCCATCGCATACCCGACATGGTCAACTCGCGT
CCCAACGCCCAGTGGAACGCCGACATGTGTGTCAACTTTGCCGCCGCCTTTCTGCAGTGGCTCTCGACCGTCATC
AACGATCAGGGTGTCTGGCGCATTTCTCGCCGCCCGAAGATCCCCTTTATCGTTGTCCACCGTGTCGAGACCACC
GGCCACGGCGATATCCTGTCCCAGGAGTTCAAGGACTGGAGGACCGAGCTCGCCAATACCCCAGCCAAGGAGTGA
Gene >Ophcf2|00617
ATGTCTTCCACTTTTAACATCCTGCCCGTCGGTCGTTTCTCCGGCGCCAGCCAGCCCGTAAAGAGACCCAAGGTA
AAAAAAAAAAAAGAAGTCCCGAGAGCAGCTCAAGACCGTCCGCATCACAGCCTGACTTTTCTCAACCTCAATCTG
AGAAACGAACTAGGAATTTGCTTGCTTCTCGTACGATGACCAGCATGAGTTCCATCTGGGCGATTCCTCCCTCAA
ATGGTACTACACTCCTCACATCGGAGCAGACCTGTCAAAGGGCTTCGATAGCTTTCAAAAGGTCGATGATTCGCG
CGATGAGCATCTCGACAGCCTCCTTCGTACCATTGTTGCGCACGAGAAGGAGACGCGTCAGCGTATCGACGCACA
CGTCGTCACCTGGCGAGGCATGATGACCAAGGTTACACACCATCTTCATCCGGACTCTCGCCAAGCGCCGGCCGT
TCTGATAGCCCGTGTCTCGTTAGATCATGGCCGCTTTGTTTGAGAAGAATGACGGGTACATTGTCATCTTGCCCG
TCCATCTCTTCATAGTCGCTCACGGCTGACTGATCTCAGCTTCGAGATGAATGCGACTCTGTATCAGGTACGCTC
ACCTTGACCCTACATTTCAATCAGACTGGCTGACGCAGGAACAACAAAGGATTGCATGTGAGAGACTATCTTAGA
TACGTCTGATCTCTCCCATGCTCACAACTCTCCTCCACCCTCCAGCTTCATCGAAGAGCACCACGAATACAAGAT
GGCCACTCGCAGACAAGAAGCACAACGACCGCGCCGAATGAACGGTCCGCCAATGGAGGTGATGCAGTTTTGGGG
TACGTCAGCAAGCTCGCCTCTTCTCCCCCGATTACACCTACCCATGGACTCACGACCGGGAACCTCAGGTTACAA
GTTCGAGACTCTGGCCACCATCCCCGCTCCCTGGGGCGAGACATCGCGGGAGTATATCGAAGGCCGCGAGAACCA
AGTCGTCAACAACAAGGAACAATACTGCTCCGTCGTCCGAACCGGCATCGGAAACACCATCCTCTGTCTCGGCGG
CGAGGTCGACGCCAGTAAGCCAACTCTTCCTCGTATAGCGGGATTCATACCTAGATAGTATGTTGCTCTCCTGAC
TGACTTTTGACTACCTACCTATTCAAACCCAGTCTGGGACTCCAAGCCCGAAACCAAAGGCGCGCCCGTCAACTG
GGTCGAGCTCAAAACAACAGCCGAGATCCGCTCACACGGCGACATGGAAGCCTTCCACCGCAAGCTGATGAAGTA
CTGGATCCAGTCTTTCCTCCTCGGCGTTCCCCGAATCATCGTCGGCTTCCGCACTCGCGATGGCTTCCTCTCCGG
CCTCGACAACATCGACACCCATCGCATACCCGACATGGTCAACTCGCGTCCCAACGCCCAGTGGAACGCCGACAT
GTGTGTCAACTTTGCCGCCGCCTTTCTGCAGTGTTTGTTTCCCGCCCCTGCTCATCACCGACTGCTGACCGCGGT
CGGAACCCGCTTCTTCAGGGCTCTCGACCGTCATCAACGATCAGGGTGTCTGGCGCATTTCTCGCCGCCCGAAGA
TCCCCTTTATCGTTGTCCACCGTGTCGAGACCACCGGCCACGGCGATATCCTGTCCCAGGAGTTCAAGGACTGGA
GGACCGAGCTCGCCAATACCCCAGCCAAGGAGTGA

© 2023 - Robin Ohm - Utrecht University - The Netherlands

Built with Python Django and Wagtail